KEGG   Rattus norvegicus (rat): 297332Help
Entry
297332            CDS       T01003                                 

Gene name
Thnsl2, RGD1309144, Tsh2
Definition
(RefSeq) threonine synthase-like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    297332 (Thnsl2)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     297332 (Thnsl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 297332
NCBI-ProteinID: NP_001009658
RGD: 1309144
Ensembl: ENSRNOG00000006508
UniProt: Q5M7T9
Position
4q31
AA seq 485 aa AA seqDB search
MWYTSTRGMAPRVNFEGALFSGYAPDGGLYMPEELPRLDKETLRHWSTLSYRSLVKELCA
LFVGLELIPRHDLNGLIDQAFSRFRHRDVVHLCKLKNGLNILELWHGVTYAFKDLSLSCT
AQFLQYFLEKKKKHVTIVVGTSGDTGSAAIESVQGSKNVDIIVLLPKGHCSKIQELQMTT
VVKENVHVFGVEGNSDELDEPIKAVFADVAFVQRHNLMSLNSINWSRVLVQMAHHFFAYF
QCTPSLDMHLLPTVEVVVPTGAGGNLAAGCIAQKMGLPISLVVAVNRNDIIHRTVQKGDF
SLCEVVRKTLASAMDIQVPYNMERIFWLLAGSDSQTTRALMEQFERTQSLHLPKDLHSKL
SEAVTSESVSDEAITQTMGRCWEENQYLLCPHSATAVSYHYQQTDSGQPSSIPRCCLAPA
SAVKFPEAVQAAGLTPETPAEILALEHKETRCTPMRRGDDWTQMLRDTIEALSLRWKGCV
ENTAE
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtggtacactagcacccggggaatggccccacgggtcaactttgagggggctctcttc
tctggttatgcaccagatgggggcctctatatgccagaggagctcccaaggctggacaaa
gagaccctgcgtcactggagcacgctgtcctatcgcagcctggtgaaggagttgtgtgcc
ctcttcgttggcctggagcttattccaagacatgacttaaatggtctgattgaccaagcc
ttcagcagattccgccatagagatgtagttcatctgtgcaagctgaagaatgggctgaac
atattggagttgtggcatggggtcacatatgcctttaaggacctgtccctgtcctgcaca
gcacagttcctgcaatacttcctagagaagaagaagaagcatgtcaccattgttgtggga
acctctggggacacggggagtgctgccattgagagtgttcaaggatccaagaatgtggac
attattgttctgttgcccaaaggacattgctcaaagattcaggagctccagatgacaact
gtggtaaaggaaaatgttcatgtgtttggagtggaaggaaacagtgatgagcttgatgaa
cccatcaaggctgtgtttgctgatgtggcctttgtccagaggcacaacctgatgagcttg
aactccatcaactggtcccgggtcctggtgcagatggcacaccacttcttcgcttatttc
cagtgcacgccgtccttggacatgcacctcctgcccacggtggaggtggtagtgccgacg
ggggctgggggtaaccttgcagctggatgcattgctcagaagatgggcctgccaatcagt
ctggtggtggcagtgaaccgcaatgacatcattcacaggactgttcagaagggagacttc
tctctgtgtgaggttgtccgaaaaaccctggcatctgctatggacattcaggtaccctac
aacatggaaaggatcttctggctgcttgctggctctgacagccagacaacaagggccctc
atggaacagtttgaaagaacccaaagtctacacctccccaaggacctacatagcaagctt
tcagaggcagtgacatctgagtccgtatctgatgaggccatcacccagaccatgggccgc
tgttgggaagagaaccagtacctactgtgccctcactcagccacagcagtgagctaccat
taccagcagactgacagtgggcagcccagtagcatcccccggtgctgcctggcccctgcc
tcagcagtcaaattcccagaagcagtccaggcggctgggctgactcctgagacccccgca
gagatcttggccctggagcacaaggagacacgctgtaccccaatgcggagaggagatgac
tggacacagatgctgcgggacacgattgaggccctgtccctgcgctggaaaggctgtgta
gagaacaccgcagaatag

DBGET integrated database retrieval system