KEGG   Rattus norvegicus (rat): 297357
Entry
297357            CDS       T01003                                 

Gene name
Ctnna2
Definition
(RefSeq) catenin alpha-2
  KO
K05691  catenin alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04390  Hippo signaling pathway
rno04520  Adherens junction
rno04670  Leukocyte transendothelial migration
rno05100  Bacterial invasion of epithelial cells
rno05200  Pathways in cancer
rno05213  Endometrial cancer
rno05226  Gastric cancer
rno05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    297357 (Ctnna2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    297357 (Ctnna2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    297357 (Ctnna2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    297357 (Ctnna2)
  09162 Cancer: specific types
   05226 Gastric cancer
    297357 (Ctnna2)
   05213 Endometrial cancer
    297357 (Ctnna2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    297357 (Ctnna2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    297357 (Ctnna2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    297357 (Ctnna2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     297357 (Ctnna2)
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 297357
NCBI-ProteinID: NP_001100068
RGD: 1305060
Ensembl: ENSRNOG00000006003
Position
4
AA seq 953 aa
MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVL
AASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKR
GTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFG
KEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANR
DYVFKQVQEAIAGISSAAQATSPTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFR
PSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGD
PLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQV
FREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQD
NMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTA
GAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANV
PQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDD
QLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCM
IMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQ
RIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVDCDVIDGGRASQLSTHL
PTCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVN
SPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFKAMDSF
NT seq 2862 nt   +upstreamnt  +downstreamnt
atgacttcggcaacctcacctatcattttaaaatgggatcccaaaagtttggaaatccgg
acactcacggtggaaagactgttggagccacttgtaacacaggtgacaacgcttgtcaac
acaagcaacaaaggtccgtctggtaaaaagaaagggaggtcaaagaaagcccatgtgctg
gcagcatctgtagaacaagctactcagaatttccttgaaaagggtgagcagatcgctaag
gagagccaggacctcaaagaagagttggtggctgctgtagaggatgtgcggaagcaaggt
gagactatgcggatcgcctcctcagagtttgctgacgacccttgctcttcggtcaagcgt
ggcacaatggtgcgggcagcacgggctctgctatcggctgtgacacgcttgctcattctg
gctgacatggcagatgtcatgagacttttatcgcatctgaaaattgtcgaggaggccttg
gaagctgtcaaaaacgctacaaatgaacaagaccttgcaaaccgctttaaagagtttgga
aaagagatggtgaaactgaactatgtagcggcaagacgacaacaggagctgaaggaccct
cactgtagggatgaaatggctgctgcccgaggagccctcaagaagaacgccaccatgctg
tacacagcctcccaagccttcctccgccacccagatgtcgcagctacaagagccaaccga
gattatgtattcaaacaagtccaggaggccatagctgggatctccagtgctgcgcaggcc
acctcgcccaccgatgaagccaaaggccacacaggcatcggcgagctggctgcagccctg
aatgaatttgataataagatcatcctggaccctatgacattcagcgaagccaggttccgg
ccatccctggaggagagactggagagcatcatcagtggggctgccctcatggcagattcc
tcctgcacacgtgatgatcgccgtgaacgtattgtggccgagtgcaacgcagtccgccag
gcgctgcaggacctgctaagcgagtacatgaataacactggaaggaaagagaaaggagac
cctctcaacattgcgattgacaaaatgaccaagaaaaccagagatctgaggagacagctt
cggaaagctgtgatggatcacatatcagattctttcttggaaaccaatgtccctttgctg
gttctcattgaggctgcaaagagtgggaatgaaaaggaggtgaaggaatatgcccaagtt
tttcgtgaacatgccaacaagctggtggaggttgccaatttggcttgttccatctccaac
aatgaggaaggggtgaagttagtcaggatggcagctacccagattgacagcctgtgtccc
caggtcatcaatgctgccctcactctggctgctcggccacagagtaaagttgctcaggac
aacatggatgtcttcaaagatcagtgggaaaagcaggtccgagtactcactgaggctgtg
gatgacatcacctcagtggatgactttctctctgtctcagaaaatcatatcttggaggat
gtgaacaaatgtgtgattgccttgcaagagggagacgtggacacactggatcgcacagct
ggggccatacgaggccgggcagcccgggtcattcacatcatcaatgccgagatggaaaac
tacgaagccggggtctatacggagaaagtgctggaagccacaaaattgctttcagaaaca
gtgatgccacgctttgctgaacaagttgaggttgccatcgaagccctgagtgccaatgtc
cctcaaccattcgaggagaatgagttcatcgatgcctcgcgcctggtgtatgatggtgtt
cgggatatcagaaaggctgtgctgatgatcaggactccagaagagctagaagatgattct
gactttgagcaagaggattatgatgtgcgtagtcggacaagtgttcagaccgaggatgac
cagctcattgctgggcagagtgcacgggccatcatggcgcaactaccacaggaggagaaa
gcaaaaatagctgagcaggtggaaattttccaccaagaaaaaagcaagctggatgctgaa
gtggccaagtgggatgacagcggcaatgacatcattgtgctggccaagcagatgtgtatg
atcatgatggagatgacagacttcacaagaggcaaaggcccactgaaaaatacatctgat
gtcattaatgctgccaagaagattgcagaagcaggctctcgaatggacaaattagcgcgc
gctgtggctgatcagtgtcctgattcagcatgtaagcaggatttattagcctaccttcag
cggattgccttgtactgccatcagcttaacatctgcagcaaagtgaaggctgaagttcag
aatctgggaggagaactcattgtgtcagggacaggagttcagagcactttcactaccttt
tatgaggtagattgtgatgtcatagatgggggcagggctagtcaactttctacccacctc
ccaacctgtgctgagggagctccaatcgggagtggaagcagtgactcctccatgctggac
agtgctacatcactcatccaggcagccaaaaacctgatgaatgcggttgtcctcacggtg
aaagcatcttatgtagcctcaaccaaataccagaaggtctatggaacagcagctgtcaac
tctccagttgtatcttggaagatgaaggctcctgaaaagaagccccttgtgaagagagag
aagcctgaagaattccagacacgagttcgacgggggtctcaaaagaaacacatttcacct
gtgcaggctttaagtgaattcaaggcaatggattccttttag

KEGG   Rattus norvegicus (rat): 307505
Entry
307505            CDS       T01003                                 

Gene name
Ctnna1
Definition
(RefSeq) catenin alpha-1
  KO
K05691  catenin alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04390  Hippo signaling pathway
rno04520  Adherens junction
rno04670  Leukocyte transendothelial migration
rno05100  Bacterial invasion of epithelial cells
rno05200  Pathways in cancer
rno05213  Endometrial cancer
rno05226  Gastric cancer
rno05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    307505 (Ctnna1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    307505 (Ctnna1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    307505 (Ctnna1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    307505 (Ctnna1)
  09162 Cancer: specific types
   05226 Gastric cancer
    307505 (Ctnna1)
   05213 Endometrial cancer
    307505 (Ctnna1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    307505 (Ctnna1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    307505 (Ctnna1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    307505 (Ctnna1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     307505 (Ctnna1)
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 307505
NCBI-ProteinID: NP_001007146
RGD: 1359485
Ensembl: ENSRNOG00000005796
UniProt: Q5U302
Position
18
AA seq 908 aa
MTAVHTGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHV
LAASVEQATENFLEKGDKIAKESQFLKEELVAAVDDVRKQGDLMKSAAGEFADDPCSSVK
RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYRAL
KPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKAN
RDLIYKQLQQAVTGISNAAQATASDDASQQQGGGGGGGELAYALNNFDKQIIVDPLSFSE
ERFRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNAGRK
ERSDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKE
YAQVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSK
LAQENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGL
DRTAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEAL
SSDPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQT
EDDQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQ
MCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLA
YLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYV
ASTKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALS
EFKAMDSI
NT seq 2727 nt   +upstreamnt  +downstreamnt
atgactgccgtccacacaggcaacataaacttcaaatgggaccccaaaagtctagagatt
agaactctggctgttgaaagactgttggagcctcttgttacacaggtgacaaccctggta
aacaccaatagtaaaggaccctctaataaaaagagaggccgttctaagaaggcccatgtt
ttggctgcatctgttgaacaagcaactgagaatttcttggaaaagggggacaaaatagca
aaagagagtcagtttcttaaggaggagcttgtggctgctgtggacgatgttcgaaaacaa
ggagatctgatgaagagcgctgctggggagtttgcagatgatccgtgctcttctgtgaag
cgaggtaacatggttcgggcagctcgagctctgctttccgccgttacccggctgctgatt
ctggctgacatggcagatgtctacaagttacttgttcagctgaaagttgtggaagacggc
atattgaagctgaggaatgctggcaacgagcaggatctagggatacagtacagagctctg
aaaccagaagtagataagctgaacatcatggcagcaaaacgacaacaggaactgaaagat
gtgggccatcgtgatcaaatggctgcagctagaggaatcctgcagaaaaatgttcccatc
ctctacactgcatcccaggcatgcctgcagcaccccgatgtagcagcctacaaggccaac
cgggacttgatatacaagcagctgcagcaggccgtcacggggatctctaatgctgcccag
gctactgcatcagatgacgcctcccagcagcagggtggcggcggcggcgggggagagctg
gcgtatgctctcaacaactttgataaacaaatcattgtggaccccttgagcttcagcgag
gaacgctttagaccttcactggaagaacgcctggaaagcataattagcggagctgccctg
atggccgactcatcctgcacacgtgatgaccggcgtgagcgcattgtggcagagtgtaat
gctgtccgccaggctctacaggacctgctatcagaatacatgggcaatgctggacgcaag
gagaggagcgacgcactcaactctgccatagataaaatgaccaagaagaccagggacctg
cgtcgacagcttcgcaaagctgtcatggaccacgtatcagattccttcctggagaccaat
gtccctcttttagtactgattgaagctgcaaagaatggaaacgagaaggaggttaaggag
tatgcccaggtttttcgtgaacacgccaacaaactgattgaggtcgccaacttggcctgt
tcaatctccaataatgaagaaggcgtgaagctcgttcggatgtctgcaagtcagttagaa
gcgctctgtcctcaggttatcaatgctgcgttggctttagcggcaaagccacagagtaaa
ctggcccaagagaacatggatctttttaaagagcagtgggaaaaacaagtccgtgttctc
acagatgctgttgatgacattacttccattgatgacttcttggctgtctcagagaaccac
attttggaagatgtgaacaagtgtgttatcgctctccaagagaaagacgtggatgggctg
gatcgcactgctggggccattcgaggccgggcagcccgagtcattcatgtcgtcacctca
gagatggacaactacgagccaggagtttacacagaaaaggttctagaagccaccaaactc
ctctccaacacagtcatgccgcgtttcactgagcaagtggaagcagctgtggaagccctc
agctcagaccccgcccagcctatggatgagaatgagttcatcgacgcctcccgtctggta
tacgacggcatccgggacatccgcaaggccgtgctgatgataaggacccccgaggagttg
gacgactctgacttcgagactgaagactttgatgtcagaagcaggaccagtgtccagaca
gaagatgaccagctgatagctggacagagcgcccgggcgatcatggctcagcttcctcag
gagcagaaggcaaagatcgcagagcaggtggccagcttccaggaggagaagagcaagctg
gacgctgaggtgtccaagtgggacgacagcggcaatgacatcattgtgctggccaagcag
atgtgcatgatcatgatggagatgaccgacttcacccgaggcaaagggccactcaaaaac
acatcggatgtgatcagtgctgccaagaaaattgctgaggcaggatccaggatggataag
cttggccggaccatcgcagaccactgcccagactccgcctgcaagcaggacctgctggcc
taccttcagcgcatcgcgctctactgccaccagctcaacatctgcagcaaggtcaaggct
gaagtacagaacctcggtggagagcttgtcgtctctggggtggacagcgccatgtccctg
atccaggcagccaagaacttgatgaacgctgtagtgcagacagtgaaggcgtcctacgtg
gcttccaccaaataccagaagtcacaggggatggcgtccctcaaccttcctgctgtgtca
tggaaaatgaaagcccccgagaagaagcccttggtgaagagagagaagcaggatgagaca
cagaccaagatcaagcgggcctcccagaagaagcacgtgaaccctgtgcaggccctcagc
gagttcaaggccatggacagcatctga

KEGG   Rattus norvegicus (rat): 361839
Entry
361839            CDS       T01003                                 

Gene name
Ctnna3
Definition
(RefSeq) catenin alpha-3 isoform X5
  KO
K05691  catenin alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04390  Hippo signaling pathway
rno04520  Adherens junction
rno04670  Leukocyte transendothelial migration
rno05100  Bacterial invasion of epithelial cells
rno05200  Pathways in cancer
rno05213  Endometrial cancer
rno05226  Gastric cancer
rno05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    361839 (Ctnna3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    361839 (Ctnna3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    361839 (Ctnna3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    361839 (Ctnna3)
  09162 Cancer: specific types
   05226 Gastric cancer
    361839 (Ctnna3)
   05213 Endometrial cancer
    361839 (Ctnna3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    361839 (Ctnna3)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    361839 (Ctnna3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    361839 (Ctnna3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     361839 (Ctnna3)
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 361839
NCBI-ProteinID: XP_008771164
RGD: 1562230
Position
20
AA seq 530 aa
MSKKTRDLRRQLRKAIIDHISDSFLDTTVPLLVLIEAAKNGQVKEIKDYASIFHEHTGRL
MEVANLACSMSTNEDGIKIVRIAANHLETLCPQIINAALALASRPKSQVVKNTMEMYKRT
WEHYIHVLTEAVDDITSIDDFLAVSESHILEDVNRCIIALRDQDADNLDRAAGAIRGRAA
RVAHIVAGEMDSYEPGAYTEGVMRNVNLLTSIVIPEFVTQVNVALDALSKNALTALDDNQ
FVDISKKIYDTIHDIRCSVMIIRTPEELEDVSDLEDDHEVRSHTSTQTEGKTDRAKMTQL
PEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKKMCMIMMEMTDFTRGKGPL
KHTTDVIYAAKMISESGSRMDVLARQIANQCPDPPCKQDLLAYLEQIKFYSHQLKICSQV
KAEIQNLGGELIVSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSSAGPRHPV
VMWRMKAPAKKPLIKREKPEETWAVVRRGSAKKKIHPVQVMSEFRGRQVY
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgagcaagaagacaagagacctccgcagacagctccgcaaagctattatagatcacata
tcagattctttcttggacacaacagttccactcctggtcctcattgaagctgctaagaat
ggccaagtgaaggaaatcaaagattatgcctccatatttcatgagcacacgggcaggctc
atggaggtggcgaaccttgcttgttccatgtcaaccaatgaagatgggattaaaatcgtc
cgaatagcagccaatcacctggagaccctgtgtccacagatcataaatgctgcacttgct
ttggcatcaagacccaagagccaagtggtcaaaaacaccatggaaatgtacaaacgcacc
tgggagcattacatccatgtcctcactgaagctgtggatgacatcaccagcatcgatgac
ttcctggctgtatctgaaagccacatcctggaagatgtcaacagatgcattatagccttg
agggatcaggatgctgacaatttagaccgagctgcaggtgccatcagaggacgggctgca
agagtagctcacatcgtcgcgggtgaaatggacagttatgaacctggtgcttacaccgaa
ggcgtgatgagaaatgtcaacctccttacaagcattgtgatcccagagttcgtgacacaa
gtgaatgttgccttggatgccttaagcaagaatgcactaactgcgctcgatgacaatcag
tttgtggacatctcaaagaagatctatgacacaatccatgatatcaggtgttcagtcatg
atcattcggactccagaggaactagaggatgtttctgaccttgaagatgaccatgaggtc
cgtagccacaccagcactcagacagaagggaaaactgatcgggccaagatgactcaactg
cctgaggcagaaaaggaaaagattgcagagcaagtagctgacttcaagaaggtgaagagc
aagctggacgctgagattgagatatgggacgacacaagcaatgatatcatcgtgcttgcc
aagaagatgtgcatgatcatgatggagatgactgacttcaccaggggcaaaggaccacta
aagcataccactgatgtaatctatgcagccaaaatgatatccgagtccggatcaaggatg
gatgttcttgctcggcagattgctaaccagtgtccagatccaccctgcaaacaagacttg
ctggcttacctggaacagattaaattctactcccaccagctgaaaatctgcagtcaagtt
aaagcagagatccaaaacctggggggagagctcatcgtgtcagctttggacagcgtcacc
tccctgatccaagcagccaagaatttaatgaatgctgtagtgcaaacagtgaaaatgtca
tacatcgcctccaccaagatcatccgcatccagagttctgcagggccccggcacccagtt
gtcatgtggagaatgaaggctccggctaaaaagcccttgattaaaagagagaagccagaa
gaaacatgggcagttgtcagaagaggctccgccaagaaaaaaatccacccagttcaagtc
atgagtgaattcagagggagacaagtctactga

DBGET integrated database retrieval system