KEGG   Rattus norvegicus (rat): 29737
Entry
29737             CDS       T01003                                 

Gene name
Kcnab1, KvBeta3
Definition
(RefSeq) potassium voltage-gated channel subfamily A member regulatory beta subunit 1
  KO
K04882  potassium voltage-gated channel Shaker-related subfamily A, beta member 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29737 (Kcnab1)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   29737 (Kcnab1)
SSDB
Motif
Pfam: Aldo_ket_red MRF_C1
Other DBs
NCBI-GeneID: 29737
NCBI-ProteinID: NP_058999
RGD: 61827
Ensembl: ENSRNOG00000056697
UniProt: P63144
Position
2q31
AA seq 401 aa
MQVSIACTEHNLKSRNGEDRLLSKQSSTAPNVVNAARAKFRTVAIIARSLGTFTPQHHIS
LKESTAKQTGMKYRNLGKSGLRVSCLGLGTWVTFGGQISDEVAERLMTIAYESGVNLFDT
AEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLSRKHIIEGLKGSLQR
LQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFN
MIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLACGIISGKYGNGVPESSRAS
LKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAVAWCLRNEGVSSVLLGSST
PEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYRS
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgcaagtctccatagcctgcacagagcacaatttgaagagtcgaaatggtgaggaccga
cttctgagcaagcagagctccaccgcccccaatgtggtgaacgcagcccgggccaaattc
cgcactgtcgctatcatcgctcgcagcctggggaccttcacccctcagcatcacatttct
ctcaaagagtccactgcaaagcagactggcatgaaatataggaatcttgggaaatcagga
ctcagagtttcgtgcttgggtcttggaacatgggtgacattcggaggtcaaatttcagat
gaggttgctgaacggctgatgacaattgcctatgagagtggagttaatctcttcgacact
gcagaagtctatgctgctgggaaggctgaggtgattctggggagcatcatcaagaagaaa
ggctggaggaggtcaagcttggtcatcacaaccaaactctactggggtggaaaagccgaa
acagaaagaggattgtcaagaaagcacatcattgaaggactgaaaggctccctccagagg
ctgcaactggaatatgtggacgtggtctttgcaaatcgcccagacagcaacacccccatg
gaagaaatcgttcgagccatgacgcacgtgatcaaccaaggcatggcaatgtactggggc
acctcgaggtggagcgcgatggagatcatggaagcctactctgtcgcgcggcagttcaac
atgatcccgcctgtctgtgagcaagctgagtatcatcttttccagagagaaaaggtggag
gtccagctgccagagctctaccataaaataggggttggtgcaatgacatggtctccactt
gcttgtggaattatttcaggaaaatatggaaatggggtgccagaaagttctagagcttca
ctgaagtgctaccagtggttgaaggaaaggattgtaagtgaagaagggagaaaacagcaa
aacaagctgaaagacctctctccaattgctgaacgcctgggatgcacactacctcagctg
gctgtggcatggtgcctgagaaacgagggtgtgagctctgtgctgctgggatcatccact
cctgaacaactcattgaaaaccttggtgccattcaggtcctccctaagatgacatcacat
gtggtaaatgagattgataacatattgcgcaacaagccctacagcaaaaaggactataga
tcctaa

DBGET integrated database retrieval system