KEGG   Rattus norvegicus (rat): 297428Help
Entry
297428            CDS       T01003                                 

Gene name
Copg1, Copg
Definition
(RefSeq) coatomer protein complex, subunit gamma 1
  KO
K17267  coatomer subunit gamma
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    297428 (Copg1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    297428 (Copg1)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    297428 (Copg1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   297428 (Copg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N COP-gamma_platf Coatomer_g_Cpla HEAT_2 Cnd1 HEAT_EZ UNC45-central
Motif
Other DBs
NCBI-GeneID: 297428
NCBI-ProteinID: NP_001026992
RGD: 1565292
Ensembl: ENSRNOG00000010474
UniProt: Q4AEF8
Position
4q34
AA seq 874 aa AA seqDB search
MLKKFDKKDEESGGGSNPLQHLEKSAVLQEARVFNETPINPRKCAHILTKILYLINQGEH
LGTTEATEAFFAMTKLFQSNDPTLRRMCYLTIKEMSCIAEDVIIVTSSLTKDMTGKEDNY
RGPAVRALCQITDSTMLQAVERYMKQAIVDKVPSVSSSALVSSLHLLKCSFDVVKRWVNE
AQEAASSDNIMVQYHALGLLYHVRKNDRLAVSKMISKFTRHGLKSPFAYCMMIRVASKQL
EEEDGSRDSPLFDFIESCLRNKHEMVVYEAASAIVNLPGCSAKELAPAVSVLQLFCSSPK
AALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGSESSIDRL
MKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEYKRAIVDC
IISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYIRFIYNRV
VLEHEEVRAGAVSALAKFGAQNEEMLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQK
ALNAGYILNGLTVSIPGLEKALQQYTLEPSEKPFDLKSVPLATTPMTEQRPESTSTAAVK
QPEKVAATRQEIFQEQLAAVPEFQGLGPLFKSSPEPVALTESETEYVIRCTKHTFSDHLV
FQFDCTNTLNDQTLENVTVQMEPTEAYEVLSYVPVRSLPYNQPGTCYTLVALPKEDPTAV
ACTFSCVMKFTVKDCDPNTGEIDEEGYEDEYVLEDLEVTVADHIQKVMKVNFEAAWDEVG
DEFEKEETFTLSTIKTLEEAVGNIVKFLGMHPCERSDKVPENKNTHTLLLAGVFRGGHDI
LVRSRLLLLDTVTMQVTARSSEELPVDIILASVG
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagaaattcgacaagaaggacgaggagtctggtggaggttccaaccccctccag
cacctggagaagagtgcagtactccaagaggctcgggtctttaacgaaactcctatcaac
ccccggaaatgtgcccacatcctcaccaagatcctttacctcataaaccagggggagcac
ctggggaccacagaagcaactgaggctttctttgccatgaccaagctctttcagtccaat
gatcccacactccgccgaatgtgctacttgaccatcaaggagatgtcctgcatcgctgag
gatgtcatcattgtgacgagcagcctgacaaaagacatgactgggaaagaggataattac
cgtggtcctgctgtccgtgccctctgccagatcactgatagcaccatgctgcaggccgtt
gagcgctacatgaaacaagcgattgtggacaaggtgcccagtgtctccagctccgccctc
gtgtcttccctgcacctgctgaaatgcagcttcgatgtggtcaagcgctgggtgaacgag
gcccaggaagcggcatccagtgataacatcatggtgcagtaccatgccctgggacttctg
taccatgtgcggaagaatgaccgcctggctgtgagtaagatgatcagtaagttcacccgg
cacggcctgaagtcccccttcgcctactgcatgatgatccgagtggccagcaagcaacta
gaagaagaagacggaagccgtgacagcccgctgtttgacttcattgagagctgcctgcgt
aacaagcatgagatggtggtgtatgaagctgcctcagccattgtcaacctgccaggctgc
agtgccaaagagctggctcctgccgtgtcagtgctccagcttttctgtagctctcccaag
gctgctcttcgctatgctgctgtgcgcactctcaataaggtggccatgaagcacccatca
gccgtgactgcctgcaatctagatctggaaaacctggtcacagactcgaaccgtagcatc
gccactttggccatcaccacactcctcaagacagggagcgagagcagcattgaccgcctt
atgaagcagatttcttccttcatgtcggagatctcagatgagttcaaggtggtggttgtc
caggccatcagcgccctgtgccagaagtatccccgaaagcatgctgtgctcatgaacttc
ctgttcaccatgctacgggaagagggtggctttgagtacaagcgtgccatcgtggactgc
atcatcagcatcattgaggagaactcagagagcaaggagacagggttgtcacacctgtgc
gagttcatcgaggactgcgagttcactgtgctggccacccgcatcctgcacctgttgggc
caggaggggcccaagaccaacaacccctccaagtacattcgctttatctacaaccgtgtg
gtcttggagcacgaagaggttcgggcaggtgcagtgagtgctctggccaagtttggagcc
cagaacgaagagatgctgcccagcatcttggtgttgctgaagaggtgtgtgatggacgac
gacaatgaagtgagagacagagccaccttctatctgaacgttctagagcagaagcagaag
gctctcaatgcaggttacatcctaaacggtctgaccgtgtccatccctggactggagaaa
gccctacagcagtatacactagaaccatcagaaaagccatttgacctcaagtctgtgcct
ctggccaccacacctatgacagagcagagaccagaaagcacctccactgcagcagtcaaa
cagccagagaaggtggcagccacacggcaggagatattccaggagcagttagcagcggtg
ccagagttccaggggctagggcccctcttcaagtcctctcctgagccggtggccctcacc
gagtcagagaccgagtatgtcatccgttgcaccaaacacaccttctctgaccacttggtg
ttccagtttgactgcacaaacaccctcaatgaccagactctggagaatgtcacagtgcaa
atggaacccactgaggcatatgaagtgctctcttatgtgcctgtgcgaagcttgccctac
aaccagcctgggacctgctacacactagtggctctgcccaaggaagaccccacagctgtg
gcatgcacattcagctgtgtgatgaagttcactgttaaggactgtgaccccaacactgga
gaaatcgatgaagaaggctatgaggatgagtatgtgctggaggatctagaagttactgta
gctgatcacatccagaaagtcatgaaagtgaactttgaagcagcctgggatgaggtggga
gatgagtttgagaaggaggaaacattcaccctgtctactatcaaaacacttgaagaggct
gtgggcaatattgtgaagtttttgggaatgcatccttgtgaaaggtcagacaaagtgcca
gaaaacaagaacactcacacgctgctgctagctggagtgttccggggtggtcatgacatc
cttgtgcgttcccggcttctgcttttggacacagtgacaatgcaggtgacagccagaagc
tcagaggagctgccagtagatatcatcttggcgtctgtgggctaa

DBGET integrated database retrieval system