KEGG   Rattus norvegicus (rat): 29743
Entry
29743             CDS       T01003                                 

Gene name
Slc25a1
Definition
(RefSeq) tricarboxylate transport protein, mitochondrial precursor
  KO
K15100  solute carrier family 25 (mitochondrial citrate transporter), member 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29743 (Slc25a1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   29743 (Slc25a1)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 29743
NCBI-ProteinID: NP_059003
RGD: 3703
Ensembl: ENSRNOG00000038001
UniProt: P32089
Position
11
AA seq 311 aa
MAAPRAPRALTAAAPGSGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERAN
PPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLD
SRRGLLCGLGAGVAEAVVVVCPMETVKVKFIHDQTSSNPKYRGFFHGVREIVREQGLKGT
YQGLTATVLKQGSNQAIRFFVMTSLRNWYQGDNPNKPMNPLITGVFGAVAGAASVFGNTP
LDVIKTRMQGLEAHKYRNTLDCGVQILKNEGPKAFYKGTVPRLGRVCLDVAIVFVIYDEV
VKLLNKVWKTD
NT seq 936 nt   +upstreamnt  +downstreamnt
atggctgcgcctcgcgcaccccgcgctctgacggctgccgctcccgggtccgggaaagcc
aaactgacgcaccccgggaaggcgatcctagcaggcggcctggctggaggcatcgaaatc
tgcatcaccttcccgaccgaatacgtgaagactcaactacagctagatgaacgcgcgaac
ccaccgcggtaccggggcattggggactgcgtgcggcaaactgtccgcagccatggcgtc
ctgggcctgtaccgcggcctcagctccttgctctacggctccatccccaaggcggctgtc
aggtttgggatgttcgagttcctcagcaaccacatgcgggatgcccaaggtagactggac
agcaggagaggactgctgtgcggtctgggtgccggcgtggcagaggcagtggtagtcgtg
tgccccatggagaccgtgaaggtgaaattcatccatgaccagacttcctccaatccaaag
taccgaggatttttccatggggttagagagattgttcgggaacaagggctaaaggggaca
taccaaggcctcacagctactgtactgaagcagggctcaaaccaagccatccgattcttc
gtcatgacctccctacgcaactggtaccaaggagacaaccccaacaagcctatgaaccca
ctgatcaccggggtctttggagctgtcgcaggtgcagccagtgtctttgggaacacaccc
ttggatgtgatcaagaccaggatgcagggcctggaggcacacaaataccggaacaccctg
gactgtggagtgcagatcctgaagaatgaggggcccaaggcattctacaagggcaccgtt
ccccggctgggccgagtctgcctggacgtggccatcgtattcgtcatctatgatgaagtg
gtgaagctgctcaataaagtgtggaagacggactaa

DBGET integrated database retrieval system