KEGG   Rattus norvegicus (rat): 297439
Entry
297439            CDS       T01003                                 

Gene name
Vom1r100, V1ra12, Vn3, Vnr3
Definition
(RefSeq) vomeronasal 1 receptor 100
  KO
K04614  vomeronasal 1 receptor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    297439 (Vom1r100)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    297439 (Vom1r100)
SSDB
Motif
Pfam: V1R SPP TAS2R
Other DBs
NCBI-GeneID: 297439
NCBI-ProteinID: NP_775418
RGD: 1549727
UniProt: Q5J3L6
Position
4q34
AA seq 311 aa
MMNKNSRVHTDSTIRNTFSTEIGIGILANSFLLLFHIFKFIRGQRSRLTDLPIGLLSLIH
LLMLLMGAFIAIDIFISWRGWDDIICKFLVYLYRSFRGLSLCTTCMLSVLQAITLSPRSS
CLAKFKHKSPHHVSCAIISLSILYMFISSHLLVSINATPNLTTNNFMQVTQSCYIIPLSY
LMQSMFSTLLAIRDISLISLMVLSTCYMEVLLCRHRNQIQHLQGTNLSPKASPEQRATQT
ILMLMTFFVLMSIFDSIVSCSRTMYLNDPTSYYIQIFVVDIYATVSPFVFMSTGKHIVNF
LKSMCVRVKNV
NT seq 936 nt   +upstreamnt  +downstreamnt
atgatgaataagaacagcagagtccacactgattctaccataaggaataccttctccact
gaaattggcattggaatcttagccaacagtttcctacttctcttccacatcttcaagttt
attcgtggacagaggtccagactcactgacctgcccattggtctcttgtccctaatccac
ctactgatgctactgatgggggcattcatagccatagacatttttatttcttggagggga
tgggatgacatcatatgtaaattccttgtctacttgtacagaagttttagaggtctctct
ctttgtaccacctgcatgttgagtgtcctgcaggccatcaccctcagccccagaagctcc
tgtttagcaaagttcaaacataagtctccccatcacgtctcctgtgccattatttcgctg
agcatcctctacatgttcattagcagtcacctcttagtatccatcaatgccacccccaat
ttgaccacgaacaactttatgcaagttactcagtcctgctacattatacccttgagttac
ctcatgcaaagcatgttttctacacttctggccatcagagatatctctcttattagtctc
atggtcctctcgacttgttacatggaggttctcttgtgtaggcacaggaatcagatccag
catcttcaagggaccaacctttccccaaaagcatctccagaacaaagggccacacagacc
atcctgatgctcatgaccttctttgtcctaatgtccattttcgacagcattgtctcctgt
tcaagaactatgtatctgaatgatccaacatcttactatattcaaatatttgtagtggac
atctatgccacagtcagcccttttgtgtttatgagcactggaaaacatatagttaacttt
ttgaagtccatgtgtgtgagggtgaagaatgtttga

DBGET integrated database retrieval system