KEGG   Rattus norvegicus (rat): 29748
Entry
29748             CDS       T01003                                 

Gene name
Ppp3r1
Definition
(RefSeq) protein phosphatase 3, regulatory subunit B, alpha
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04720  Long-term potentiation
rno04724  Glutamatergic synapse
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04924  Renin secretion
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05031  Amphetamine addiction
rno05152  Tuberculosis
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29748 (Ppp3r1)
   04310 Wnt signaling pathway
    29748 (Ppp3r1)
   04370 VEGF signaling pathway
    29748 (Ppp3r1)
   04020 Calcium signaling pathway
    29748 (Ppp3r1)
   04022 cGMP-PKG signaling pathway
    29748 (Ppp3r1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    29748 (Ppp3r1)
   04218 Cellular senescence
    29748 (Ppp3r1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    29748 (Ppp3r1)
   04650 Natural killer cell mediated cytotoxicity
    29748 (Ppp3r1)
   04660 T cell receptor signaling pathway
    29748 (Ppp3r1)
   04658 Th1 and Th2 cell differentiation
    29748 (Ppp3r1)
   04659 Th17 cell differentiation
    29748 (Ppp3r1)
   04662 B cell receptor signaling pathway
    29748 (Ppp3r1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    29748 (Ppp3r1)
   04921 Oxytocin signaling pathway
    29748 (Ppp3r1)
   04924 Renin secretion
    29748 (Ppp3r1)
  09156 Nervous system
   04724 Glutamatergic synapse
    29748 (Ppp3r1)
   04720 Long-term potentiation
    29748 (Ppp3r1)
  09158 Development and regeneration
   04360 Axon guidance
    29748 (Ppp3r1)
   04380 Osteoclast differentiation
    29748 (Ppp3r1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    29748 (Ppp3r1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29748 (Ppp3r1)
   05014 Amyotrophic lateral sclerosis
    29748 (Ppp3r1)
   05020 Prion disease
    29748 (Ppp3r1)
   05022 Pathways of neurodegeneration - multiple diseases
    29748 (Ppp3r1)
  09165 Substance dependence
   05031 Amphetamine addiction
    29748 (Ppp3r1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    29748 (Ppp3r1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    29748 (Ppp3r1)
   05170 Human immunodeficiency virus 1 infection
    29748 (Ppp3r1)
   05163 Human cytomegalovirus infection
    29748 (Ppp3r1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    29748 (Ppp3r1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    29748 (Ppp3r1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     29748 (Ppp3r1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 29748
NCBI-ProteinID: NP_059005
RGD: 69230
Ensembl: ENSRNOG00000043210
Vega: OTTRNOG00000001399
UniProt: P63100
Position
14q22
AA seq 170 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggcgagttaccctttggaaatgtgctcacacttcgatgctgatgagatt
aaaaggctaggaaagagattcaagaagcttgacttggacaactctggttctttgagcgtg
gaggagttcatgtctctgcctgagttacaacagaaccctttagtacagcgggtcatagat
atattcgacacagacgggaatggagaagtggacttcaaagaattcattgaaggagtctct
cagttcagtgtcaaaggcgataaggaacagaagttgaggttcgctttccgtatctacgac
atggataaagacggctatatttccaatggagagctcttccaggtgttgaagatgatggtg
ggcaacaacctgaaagatacgcagttacagcagattgtagacaaaaccataataaacgca
gataaggacggggacgggagaatatcctttgaggagttctgtgctgttgtaggtggccta
gatatccacaaaaagatggtggtggatgtgtga

DBGET integrated database retrieval system