KEGG   Rattus norvegicus (rat): 297483Help
Entry
297483            CDS       T01003                                 

Gene name
Shq1, RGD1310610
Definition
(RefSeq) SHQ1, H/ACA ribonucleoprotein assembly factor
  KO
K14764  protein SHQ1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    297483 (Shq1)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic Type
  Sno RNPs
   Box H/ACA snoRNPs
    297483 (Shq1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SHQ1
Motif
Other DBs
NCBI-GeneID: 297483
NCBI-ProteinID: NP_001128185
RGD: 1310610
Ensembl: ENSRNOG00000005433
UniProt: B4F784
Position
4q34
AA seq 603 aa AA seqDB search
MLTPAFELTQDRDFLTVAIRVPHARASEFDVYFEGVDFKFYAKPYFLRLTLPGRIVENGS
EQGSYDADKGIFTIRLPKETPGQHFEGLNMLTALLAPRKSRSAKPLVEEIGASGVSEEGA
DDEDEEFDWEIEQTPYEEVSESTLRSQCHYGFGNLRAGVVQRLQDELSEVIDIKDPDFTP
VTERRQKRLAAELAKFDPDHYLADFFEDEAVEQVLKYSPWWNDVHTEMMASLGKSQEQGD
AAALVSFSEEEKYQLRKFVNKSYLLDKTAHRQVYYSLVDILLAYCYEVRVTEGEHNVESA
WTIRKLSPTLCWFETWTDVHEILVSFGRRVLCYPLYRHFKLVLKAYRDTLKILQLGKSAV
LKCLLDVHKIFQENDPAYILNDLYISDYCVWIQKAKSKKLAALTEALEAVSLSKAQLGFE
LLELEAAAILVQEEETAGKTAQCSPTEQVPHSSPEPSDSDSTSSSDTEDSASVQEELVGT
QPSLLTSLQVPLLEEDSALTIRDSGLCRNMGSQKCEVRQGQPLASPRAPLIEEVGDSGLC
RNMASQGCEVSQEQPLASPRAPLIEEVGDELKTMLWVSTPSGVNAGSHRSVQDAKERDQV
PCD
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgctaactcctgcgttcgaactgacccaggaccgcgacttccttaccgtcgccatccgc
gtgccccacgcgcgcgcctccgagttcgacgtgtacttcgagggggtggacttcaagttc
tacgccaagccgtactttctgaggttaacacttcctggaaggattgtagaaaatggatct
gagcagggatcctatgatgcagataaaggaatttttaccattcgattgcccaaggaaact
cctggccagcattttgaggggctgaacatgttaactgcgcttctggcaccaagaaaatcc
aggtctgccaaaccgcttgtggaagaaataggtgcttccggggtttctgaggaaggagct
gatgatgaggatgaagagtttgactgggaaattgagcagactccctatgaagaggtctca
gaaagtactctgcgatcgcagtgtcactatggatttggaaacctgcgagcaggtgtggtt
cagcggttacaggatgaactgagtgaggttatcgatattaaggatccagatttcactcct
gtgactgaacggaggcagaaacgcctggccgctgaattggccaaatttgatccagatcat
tatctagctgacttctttgaagatgaggcagttgaacaggttttgaagtacagtccttgg
tggaacgatgtgcacacagaaatgatggcctctttgggaaagagccaagagcaaggggat
gctgctgccttagtatctttttcagaagaggaaaaataccagctacgaaagtttgtgaat
aaatcttacctgctggacaagacagctcaccgtcaagtgtactatagtttagttgacatc
cttctggcctattgctatgaagtacgtgtgactgaaggagagcacaacgtggagtctgcg
tggaccatcaggaagctgagccctacactctgctggtttgagacatggacagacgttcat
gaaatcctggtgtcttttggacggagagttttgtgctatccgctctatcgccatttcaag
ctggtgctgaaagcctacagagatactctaaagatactgcaactcggtaagagtgcagtt
ttgaagtgtctcctggatgttcacaaaatcttccaggaaaacgacccagcatatattttg
aatgatctctacatctcagactactgtgtatggattcagaaggccaagtccaaaaagttg
gctgccctaacagaagctttggaagcagtctcactcagtaaggcccagctgggattcgag
ctgctagaactggaagctgctgcaattcttgtccaggaggaagaaactgccggaaagaca
gcccagtgcagtcctacagagcaggttccacactccagccctgagcccagtgactcagac
agcacctcatcatctgacacagaagactcagcgtcagtgcaagaggagcttgtcgggacc
cagccctccctgctcacttctctgcaagtcccccttttggaagaggacagtgccctgacc
atcagagatagtgggctctgcagaaacatgggcagtcagaaatgtgaagttcgtcaaggt
cagccactggcctctccccgggctcctctgatagaggaggttggagatagtggactctgc
agaaacatggccagccagggatgtgaagtcagtcaagagcagccactggcctctccccgg
gctcctctgatagaggaggttggagatgaactgaagaccatgctttgggtttccacaccc
agtggtgtcaatgctgggagccacaggagtgtacaggatgcaaaggagagggatcaggtg
ccctgtgattga

DBGET integrated database retrieval system