KEGG   Rattus norvegicus (rat): 297498Help
Entry
297498            CDS       T01003                                 

Gene name
Crbn
Definition
(RefSeq) cereblon
  KO
K11793  cereblon
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    297498 (Crbn)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     297498 (Crbn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LON_substr_bdg Yippee-Mis18 Baculo_ME53
Motif
Other DBs
NCBI-GeneID: 297498
NCBI-ProteinID: NP_001015003
RGD: 1310533
Ensembl: ENSRNOG00000006534
UniProt: Q56AP7
Position
4q41
AA seq 445 aa AA seqDB search
MAGEGDHQDAAHNMGNHLPLLPADSEDEDDEIEMEVEDQDSKEARKPNIINFDTSLPTSH
TYLGADMEEFHGRTLHDDDSCQVIPVLPEVMMILIPGQTLPLQLSHPQEVSMVRNLIQKD
RTFAVLAYSNVQEREAQFGTTAEIYAYREEQEFGIEVVKVKAIGRQRFKVLELRTQSDGI
QQAKVQILPECVLPSTMSAVQLESLNKCQIFPSKPISWEDQYSCKWWQKYQKRKFHCANL
TSWPRWLYSLYDAETLMDRIKKQLREWDENLKEDSLPANPIDFSYRVAACLPIDDVLRIQ
LLKIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVH
ETLTVYKASNLNLIGRPSTVHSWFPGYAWTIAQCKICASHIGWKFTATKKDMSPQKFWGL
TRSALLPTIPETEDEISPDKVILCL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgagggagatcaccaggacgctgcgcacaacatgggaaaccacctgccgctt
ctgcctgctgacagtgaagatgaagatgatgaaattgaaatggaagttgaagaccaggac
agtaaagaagccagaaaaccaaatatcataaactttgataccagtctgccaacctcacat
acatacctgggagctgatatggaagagtttcacggcaggactttgcacgacgacgacagc
tgtcaggtgattccagttcttcctgaggtgatgatgatcttgattcctgggcagacgtta
ccactgcagctttctcacccgcaagaagtcagtatggttcggaatttaatccagaaggac
agaacctttgcagttcttgcatacagtaatgtgcaagaaagggaagcacagtttggaact
acagcagagatctatgcgtatcgagaggagcaggagtttggaattgaagtagtgaaagtg
aaagcaatcggacggcagaggttcaaggtccttgaacttcgaacacagtcagatggaatc
cagcaagctaaagtgcaaattttgccagagtgtgtgttgccgtcaaccatgtctgcagtt
cagttagaatcactcaataagtgccagatatttccttcaaaacctatctcttgggaagac
cagtattcatgtaaatggtggcagaaataccagaagaggaagtttcactgtgcaaatctg
acatcatggcctcgctggctgtattcattatatgatgctgaaacattaatggatagaatt
aagaaacagctacgtgaatgggatgaaaatctcaaagaggactctcttcctgcaaaccca
atagacttttcttacagagtagctgcttgtcttcctattgatgatgtattaagaattcag
ctccttaaaattggcagtgctattcaacggcttcgctgtgagttagacatcatgaacaaa
tgtacttccctttgctgtaaacaatgtcaagaaacagaaataacaacaaagaatgaaata
tttagcttatccttatgtggtccaatggcagcatatgtgaatccccatggatatgtacat
gagacactgactgtgtataaagcttccaacctgaatctgataggccggccttctacagtg
cacagctggtttcccgggtatgcatggaccattgcccagtgtaagatttgtgcaagccac
attggatggaaatttacagccaccaaaaaagacatgtcacctcaaaaattttggggctta
actcgctctgctctgttacctacaattccagagactgaagatgaaataagtccagacaaa
gtaatactttgcttataa

DBGET integrated database retrieval system