KEGG   Rattus norvegicus (rat): 297504Help
Entry
297504            CDS       T01003                                 

Gene name
Edem1, RGD1563633
Definition
(RefSeq) ER degradation enhancing alpha-mannosidase like protein 1
  KO
K10084  ER degradation enhancer, mannosidase alpha-like 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    297504 (Edem1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:rno04091]
    297504 (Edem1)
Lectins [BR:rno04091]
 M-type lectins
  297504 (Edem1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_47
Motif
Other DBs
NCBI-GeneID: 297504
NCBI-ProteinID: NP_001292208
RGD: 1563633
Ensembl: ENSRNOG00000055365
UniProt: D3ZJE0
Position
4q41
AA seq 650 aa AA seqDB search
MQWRALVLGLVLLRLGLHAVLWLVFGLGPSMGFYQRFPLSFGFQRLRDPDGSGPVGPPGG
PSWLHRPRRGTEGRLETPPGPGPGPGVCGPAHWGYALGGGGCGLDEYERRYSGAFPPQLR
AQMRDLARGMFVFGYDNYMAHAFPQDELNPIYCRGRGPDLGDPSNLNINDVLGNYSLTLV
DALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSKQP
FGDMTIEDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCTAGAG
SLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWVGKQSGLGA
GLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQSYLRRGREACNEGEGDPPLYVNVNMFS
GQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERYNWQLQAPDVLF
YPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKSKEDRME
SFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISVDKRLRELPWKEFFSEDGERDQ
EEKFVHRPKSQELRVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGLI
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgcaatggcgagcgctcgtcctggggctggtgctgctgcgcctcggcctccacgcagtg
ctctggttggtcttcgggctggggcccagcatgggcttctaccagcggtttccgctcagt
ttcggcttccagcgcttgagggaccccgacggctcggggccagttggtcctccgggaggc
ccgtcctggcttcatcggccaaggcgcgggacagaggggcggctcgagaccccgccggga
ccagggccgggaccgggcgtgtgcggcccggcgcactggggctatgctttgggcggcggt
ggctgcggcctggacgagtacgagcggcgctacagcggcgccttcccgccgcagctgcgt
gcccagatgcgcgacctggcgcggggcatgttcgtcttcggctatgacaactacatggcg
cacgcctttccgcaggacgagctcaaccccatctactgccgcggccgggggcctgacctc
ggagacccttcaaatctgaacatcaacgatgtactaggaaattactctctgaccctggtt
gatgccttggatacactcgcaataatgggaaattcatccgagttccagaaagcagtcaag
ttagtgatcaacaccgtttcatttgacaaagattccaccgtccaagtctttgaggccacg
ataagggttctgggaagcctcctttctgctcatagaataataactgactccaaacagccc
tttggtgacatgacaattgaggattatgataacgaattgttgtacatggcccatgacctg
gctgtgcggcttcttccagcttttgaaaacaccaagacagggatcccctatcctcgggtg
aatctgaagacgggtgtccctcctgacagcaataatgagacctgcacagcaggggctggt
tctctcctggtggaatttgggattctgagccgactgctgggggattccacttttgagtgg
gttgccagacgagctgtgaaagccctctggaaccttcggagcaacgatacaggattatta
ggcaatgttgtgaacatccagacaggccattgggttggaaagcagagtggcttgggtgct
gggctggattccttctatgaatacctcttgaaatcttacattctttttggagaaaaagaa
gatctagagatgtttaatgcagcttatcagagcatccagagctacctgcgaagaggccgg
gaagcctgcaatgaaggagaaggagacccaccgctctacgtcaacgtgaacatgttcagt
gggcagctcatgaacacctggattgactctctgcaggctttcttcccggggctgcaggtt
ctgataggggatgtggaagacgccatctgcctacacgccttctactacgccatatggaaa
cgctatggggccctccctgagcgctataactggcaactgcaggcccctgatgttctcttc
taccccctgagaccagagttagtggagtccacatatctcctctaccaggcgaccaagaat
cccttctacctccatgtaggaatggacattctgcagagtctcgaaaaatacacaaaagtc
aaatgtggatatgccacgctgcaccatgtcatagacaagtctaaagaagaccggatggag
agcttcttcctcagcgagacttgcaaatacttgtatctgctgtttgatgaagagaatcca
gtacacaaatctggaaccagatacatgtttacaactgagggccatatcatatctgtggac
aaacgtcttcgggaattgccttggaaggaattcttctctgaagatggggagcgggaccaa
gaggaaaagtttgtgcacaggcctaagtctcaggagcttagagtcattaactccagttct
aattgcaatcgtgttcctgatgagaggagatactccctgcccttaaagagcatctacatg
cgccagatcgaccagatggttggcttgatttga

DBGET integrated database retrieval system