KEGG   Rattus norvegicus (rat): 297514
Entry
297514            CDS       T01003                                 

Gene name
Setd5, RGD1310433
Definition
(RefSeq) SET domain containing 5
  KO
K23216  SET domain-containing protein 5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    297514 (Setd5)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   Other histone modification proteins
    297514 (Setd5)
SSDB
Motif
Pfam: SET
Other DBs
NCBI-GeneID: 297514
NCBI-ProteinID: NP_001100084
RGD: 1310433
Ensembl: ENSRNOG00000007472
UniProt: D4A2W7
Position
4q42
AA seq 1446 aa
MEVLRDPIKKNSSESKPAQSGFSRGNSPLCCPESVEASPAVNEKSLYSTHNYGTTQRHGC
RGLPYATIIPRSDLNGLPSPVEERCGDSPNSEGETVPTWCPCGLSQDGFLLNCDKCRGMS
RGKVIRLHRRKQDNISGGDSSATESWDEELSPSTVLYTATQHTPTSITLTVRRTKPKKRK
KSPEKGRAAPKTKKIKNSPSEAQNLDENTTEGWENRIRLWTDQYEEAFTNQYSADVQNAL
EQHLHSNKEFVGKPAILDTINKTELACNNTVIGSQMQLQLGRVTRVQKHRKILRAARDLA
LDTLIIEYRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNGVEMCVDARTFGNDARFIRRS
CTPNAEVRHMIADGMIHLCIYAVSAITKDAEVTIAFDYEYSNCNYKVDCACHKGNRNCPI
QKRNPNAAELPLPPPSFPTIGAETRRRKARRKELEMEQQNEVPEENHDPQPQEVPEKVTV
SSEHEEVDNPEEKPEEEKEEATDDQENSAHSRRTREDRKVEAIMHAFETLEKRKKRRDQP
VEQSNSDVEITTSSSEIGVGEETKTAAPESEVNNPVTNIAIPSIPQSTGVNTRRSSHAGD
VAAEKPVPKPPPAKPSRPRPKSRISRYRTSSAQRLKRQKQANAQQAELAQAALEEGGSNN
SVTLPEAGNIDSSGESRPLTGSDPTVVSVTGSHVNRAASKYPKTKKYLVTEWLNDKAEKQ
ECPVECPLRITTDPTVLATTLNMLPGLIHSPLICTTPKHYIRFGSPFMPERRRRPLLPDG
TFSSCKKRWIKQALEEGMTQTSSVPQETRTQHLYQSNENSNSSSICKDNADLLSPLKKWK
SRYLMEQNITKLLRPLSPVTPPPPSSGSKSPQLTTPGQTHPGEEECRNGYSLMFSPITSL
TTASRSNTPLQFELCHRKDLDLTKVGYPDSSTHSCGDRPSLLNCSHPDLTSHPSVAPTSE
AGFPSRSGDGPQTLLRNSDQAFRTEFNLMYAYSPLNAMPRADGLYRGSPLVGDRKPLHLD
GGYCSPAEGFSSRYEHGFMKDLSRGSMSPGGERTCEGVPSAPQNPPQRKKVSLLEYRKRK
QEAKENSGGGSDSSQSKSKSSGAGQGSSNSVSDTGAHGVQGSSARTPSSPHKKFSPSHSS
TSHLEAVSPSDSRGTSSSHCRPQENISSRWMVPTSVERLREGGSIPKVLRSSVRVAQKGE
PSPTWESNITEKESDPADGEGPEPLSSALSKGATVYSPSRYSYQLLQCDSPRTESQSLLQ
QSSSPFRGHPTQSPGYSYRTTALRPGNPPSHGSSESSLSSTSYPSPAHPVSTDSLAPFTG
TPGYYSSQPHSGNSTGSNLPRRSCSSSAASPTPQGPSDSPTSDSVSQSSTGTLSSTSFPQ
NSRSSLPSDLRTISLPSAGQSAAYQASRVSAVSSSQHYPHRGSGGVHQYRLQPLQGSGVK
TQTGLS
NT seq 4341 nt   +upstreamnt  +downstreamnt
atggaagtattaagagatccaattaagaagaatagttctgagtctaaaccagcccagagt
ggcttctctaggggaaactccccgctctgctgccctgaatctgtggaggctagtccagca
gttaatgagaagagcctgtactccactcataattatgggaccactcagaggcatgggtgt
cgaggactgccttatgctacgatcatccctcgttctgacctgaatggcctgccgtcgccc
gtagaggaacgctgtggagacagcccgaactctgaaggagagactgttcctacctggtgt
ccttgtggtctttctcaggatggcttccttctcaactgtgacaagtgcaggggaatgagc
agggggaaggttattagacttcatcggcggaagcaggacaacatatcaggtggggatagc
agtgcaacagaaagctgggatgaggagctttctccttccactgtgttgtacacagcaaca
cagcacacacctacaagcatcaccttaactgttagaagaaccaaacccaagaagcggaaa
aagagtccagaaaagggtcgtgcagcaccaaagacgaagaagatcaagaattctccctct
gaagcacagaatttagatgaaaataccactgagggctgggaaaatcggataagactatgg
actgatcaatatgaagaagctttcactaatcagtacagtgcggatgtacagaatgccctt
gaacaacatctccattcaaacaaggaatttgtgggcaaacctgctattttagacactatt
aataaaactgaactggcctgtaataatacagtaattggttcccaaatgcagttacagctg
ggaagagtcacccgtgttcaaaagcaccggaaaatcctgagggctgcaagagatttggct
ttggacactcttataatagaatatcgtgggaaagtcatgttacgacaacaatttgaggtc
aatgggcatttcttcaaaaaaccatatccctttgtgctcttctactcaaaattcaatggt
gtagagatgtgtgtcgatgctcgtactttcggtaatgatgctcggttcatcagaagatct
tgtacaccaaatgcagaggtgagacacatgattgcagatgggatgattcacctgtgtatc
tatgctgtatctgctatcaccaaggatgctgaagtcaccattgcatttgattatgaatat
agtaattgtaattacaaagtggactgtgcttgtcacaagggaaaccggaattgccccata
cagaaaagaaatcccaatgctgcagaattgccactcccacctcctagctttcccaccatt
ggagcagagaccagacgtagaaaagcacggcggaaagagctggagatggagcagcaaaat
gaggttccagaagagaatcatgacccacaaccacaagaagttccagaaaaagtaactgta
tccagtgagcatgaggaagttgacaatccagaagaaaaaccggaagaagaaaaagaagag
gccacagacgaccaggagaactcagctcatagcagaaggactcgggaagataggaaggtt
gaagccatcatgcatgcttttgaaactttagagaagagaaagaaacggcgggatcagcct
gtagagcagagcaactcagacgtagagattactactagcagttcagagataggagttgga
gaagagacaaaaactgcagcccccgagtcagaagttaacaaccctgttacaaacattgcc
atcccaagcatcccacagagcactggtgtgaatactcggcggtcttcccatgctggggat
gtagcggcagaaaagccagtccccaaaccacctccagctaagccttctagaccccgaccg
aagagtagaatttctcggtaccggaccagttcagcccaaagactaaaacgtcagaagcag
gccaacgcacaacaggcagagctcgcacaagctgccttggaagaaggaggaagtaacaac
tcagtaactcttcctgaagctggaaatatagacagttcaggagagagcagaccgttaaca
gggtctgacccaactgtggtatcagttactggatcccatgtcaatcgtgctgcatctaaa
taccccaaaaccaaaaagtatctagttacagaatggttaaatgacaaggcagagaagcaa
gaatgccctgtcgagtgtcctttgcgtatcaccactgacccaactgtattggcaacaacc
ctgaacatgctaccgggtcttattcattccccattaatttgtacgacccccaaacactac
attcgctttggctcaccctttatgcctgagaggcgtcgaaggccccttctgcctgatggc
acattcagctcctgtaagaagcgctggataaagcaagctttggaagaagggatgactcag
acatcatctgtgccccaagagactagaacacagcacctataccaaagtaatgagaatagt
aattcttctagtatctgtaaagataatgcagacttattgagcccattaaagaaatggaag
tctcgctatctgatggagcagaatatcaccaagttgcttcggcctctgtctccagttaca
ccacccccacccagctcaggctcaaagagtccccagctgaccacacctggccagactcac
ccaggagaagaggagtgtcgaaatggatacagcctcatgttctcaccaatcacatctctt
actactgctagtcgttccaacactcctctgcagtttgagctttgtcaccgaaaagaccta
gatttgacaaaagtgggatacccagactccagcactcacagctgcggtgataggccttcc
ctgctcaactgcagtcatcctgacctgacttctcatccctccgttgctcccacctccgag
gctggcttcccaagcaggagtggagatggtcctcagaccttgctgagaaactcagaccag
gcgtttaggacagagttcaatttgatgtacgcctactcccctttgaatgctatgcctcga
gcagatggactatatagagggtctcccttggtgggggacaggaagcctttacatttagat
ggaggatattgttcccctgcagaaggcttttctagcagatatgaacatggctttatgaaa
gacctctctcggggatccatgtcacctggtggtgaaaggacctgtgaaggagtcccatct
gctcctcagaacccaccacaaaggaaaaaggtgtccttgctagagtaccgcaaaaggaaa
caagaagctaaggagaattctggtgggggaagtgactcttcacagagcaaaagcaagtct
tcaggagctgggcaaggcagcagtaattctgtttctgacactggtgcccatggtgtgcag
ggatcctcagcccgaaccccctcatcccctcacaaaaagttttccccatctcattcctct
acatcacatttggaggcggtaagcccatcagattccaggggcacttcttcctctcactgc
agacctcaagaaaacatcagcagtagatggatggttcctacatcagttgaacgactccga
gaaggaggtagcatccctaaggttcttcgaagcagtgtgagagttgcccaaaagggagag
ccatctcccacgtgggagagcaacatcacagagaaagagtcagaccctgcagatggagaa
ggcccagagccattaagctcagcactctctaaaggagcaactgtttacagcccatccaga
tatagctaccagctcctgcagtgtgacagtccgaggacagaatcacaaagcctccttcag
cagagttcgtccccctttagaggacatcccacccaatctccaggatacagttatcgaact
actgcactgagacctggaaaccctccctctcatggttcttcggaatcatccctctcttcc
acgtcctaccccagccctgcccaccctgtgtctacagactcgttggccccatttacgggg
actccagggtattacagcagccagccgcattctggaaacagcactggcagcaatcttcca
aggaggagctgttcttcgagtgctgctagccctaccccacagggcccctcagactcaccg
acctcagactcggtttctcagtccagcacaggaactctgagttccacctcctttcctcag
aactctaggtcgtcattgccatcagacttacggactatcagtctgcccagtgctgggcag
tcagctgcctaccaggcctccagggtatctgcggtttccagttcacagcactacccacat
cgtgggagtgggggtgtacaccagtaccgactccagccattgcaagggtcaggagtcaag
actcagacaggactttcctag

DBGET integrated database retrieval system