KEGG   Rattus norvegicus (rat): 297516Help
Entry
297516            CDS       T01003                                 

Gene name
Cpne9, RGD1309212
Definition
(RefSeq) copine family member 9
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Copine C2 vWA-TerF-like VCBS
Motif
Other DBs
NCBI-GeneID: 297516
NCBI-ProteinID: NP_001020153
RGD: 1309212
Ensembl: ENSRNOG00000023077
UniProt: Q5BJS7
Position
4q42
AA seq 553 aa AA seqDB search
MSLGGASERSVPATKIEITVSCRNLLDLDTFSKSDPMVVLHTQSRASQEWREFGRTEVID
NTLNPDFVRKFVLDYFFEEKQNLRFDVYNVDSKANISKPKDFLGQAFLALGEVIGGQGSR
VERPLTGVPGKKCGTILLTAEELSNCRDIATMQLCANKLDKKDFFGKSDPFLVFYRSNED
GTFTICHKTEVVKNTLNPVWQPFSIPVRALCNGDYDRTVKIDVYDWDRDGSHDFIGEFTT
SYRELSKAQNQFTVYEVLNPRKKCKKKKYTNSGTVTLLSFSVDSEFTFVDYIKGGTQLNF
TVAIDFTASNGNPLQPTSLHYMSPYQLSAYAMALKAVGEIIQDYDSDKLFPAYGFGAKLP
PEGRISHQFPLNNNDEDPNCAGIEGVLESYFQSLRTVQLYGPTYFAPVINQVARAAAKIS
DGSQYYVLLIITDGVISDMTQTKEAIVSASSLPMSIIIVGVGPAMFEAMEELDGDDVRVS
SRGRYAERDIVQFVPFRDYVDRSGNQVLSMARLAKDVLAEIPEQLLSYMRTRDIQPRPPP
PANPNPTSAPEQP
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcggcggagcttcagagcgtagcgtcccggccaccaagattgaaattactgtg
tcgtgccggaatctgctagacctggatacattctccaagtcggaccccatggtggtgctt
cacacgcagagccgggccagccaggagtggcgggagttcggacgaaccgaggtgattgac
aacacactgaacccagacttcgtgcgcaaattcgttctcgactatttctttgaggaaaag
caaaatctccgcttcgatgtgtacaacgtcgactctaaagccaatatctccaaaccgaag
gatttcctgggacaagcattcctggccctgggagaggtgattggaggccagggcagccgt
gtggagcgacctcttacgggtgtgccaggcaagaagtgtggaaccatactgctgactgcc
gaggagctcagcaactgccgggacattgccaccatgcagctgtgtgcaaacaagctggac
aaaaaggacttctttgggaagtcagaccctttccttgtgttctacaggagcaatgaagac
ggcacgttcaccatctgccacaagacagaggttgtaaaaaacacactgaacccagtatgg
cagcccttcagcatccctgtgcgggcgctgtgcaatggagactatgacagaacagtgaag
atcgacgtatatgactgggaccgagatggaagccatgacttcatcggtgagttcacaacc
agctaccgggagctgagcaaggcccagaatcagttcacagtgtatgaggtacttaaccct
cggaagaaatgcaagaagaagaaatataccaactcggggaccgtgacgctcctttccttc
tctgtggactcagaattcacttttgtggattacatcaagggagggacgcagctgaacttc
acggtagctattgacttcacggcttccaacgggaaccccctgcagcctacctcgctgcac
tacatgagtccctaccagctcagtgcctatgccatggccctcaaggcagtgggagagatc
atccaggactatgacagtgacaagctcttcccagcctatggttttggggccaagctgccc
ccagaggggcggatctcccaccagttccccctgaacaataatgatgaagaccccaactgt
gcaggcattgagggtgtgctggagagttacttccaaagtctgcgcacggtgcagctctat
gggcccacttactttgcgcctgtcatcaaccaggtggccagggctgcagccaaaatctcg
gatggttcccagtactacgttctgctcattatcactgatggcgtcatctctgacatgaca
cagaccaaagaggccatcgtcagtgcgtcctcgctgcccatgtctatcattattgtgggt
gttggacctgccatgtttgaggcaatggaagaactggatggtgatgatgtgcgtgtgtcc
tcccggggacgctatgcagagcgggacatcgttcagtttgtcccattccgagattatgtt
gaccgatcagggaaccaggtgctgagcatggcacgactggccaaggatgtgctagcagag
attccggagcagctgctgtcctacatgcgcaccagggacatccagcctcgacctcctccc
cctgctaaccccaacccaacctcagccccagaacagccctga

DBGET integrated database retrieval system