KEGG   Rattus norvegicus (rat): 297523
Entry
297523            CDS       T01003                                 

Gene name
Vgll4
Definition
(RefSeq) vestigial-like family member 4
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: VGLL4 Vg_Tdu
Other DBs
NCBI-GeneID: 297523
NCBI-ProteinID: NP_001015004
RGD: 1311653
Ensembl: ENSRNOG00000007822
UniProt: Q5BJP0
Position
4q42
AA seq 287 aa
MLFMKMDLLNYQYLDKMNNNIGVLCYEGEASLRGEPRMQTLPVASALSSHRTGPPPISPS
KRKFSLEHGDKDLDCENDHVSKMSRIFSPHLNKTVNGDCRRDPRERSRSPIERAAAPAVS
LHGGHLYASLPSLMEQPLALTKNSSDTGRSAVERQQNRPSVITCASAGARNCNLSHCPIA
HSGCSAPGSASYRRPPSATATCDPVVEEHFRRSLGKNYKEPEPAPNSVSITGSVDDHFAK
ALGDTWLQIKAAKDSASSSPESASRRGQPASPTAHMVSHSHSPSVVS
NT seq 864 nt   +upstreamnt  +downstreamnt
atgctgtttatgaagatggacctgttgaactaccagtacttggacaagatgaacaacaat
atcggcgttctgtgctatgaaggtgaagcttccctcaggggagaacccagaatgcagacc
ctcccggtggcctcagctcttagcagccaccgcacaggtccgcctcccatcagccccagc
aagaggaaattcagcctggaacacggggacaaggacttggactgtgaaaatgaccacgtc
tccaagatgagccgaatcttcagcccccatttgaataagactgtcaacggagactgccgc
agagatccccgggaacggagccgcagtcccatcgaacgggctgcagcccccgctgtaagc
ttgcatggtggccacctgtatgcatccctccccagcctcatggagcagcctcttgccctg
actaagaacagcagtgacacaggaaggtcagctgtggagcggcagcagaaccggccctcc
gtcatcacctgtgcatctgccggcgcccgcaactgcaacctctctcactgtcccatcgca
cacagtggctgttctgcgcctgggtctgccagctaccggagaccacccagtgcgactgcc
acctgtgaccctgtggtggaagagcacttccgtcggagcctgggcaagaactacaaggaa
ccagagccagcacctaactccgtgtccatcactggctctgtggacgaccactttgccaaa
gcactaggtgacacatggcttcagatcaaagcggccaaggacagcgcatccagcagccca
gagtcagcctcacgcaggggccagccagccagccccactgcccacatggtcagccacagt
cactctccctctgtggtctcctga

DBGET integrated database retrieval system