KEGG   Rattus norvegicus (rat): 297530
Entry
297530            CDS       T01003                                 

Gene name
Washc2c
Definition
(RefSeq) WASH complex subunit 2
  KO
K18462  WASH complex subunit FAM21
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    297530 (Washc2c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    297530 (Washc2c)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Others
   WASH complex
    297530 (Washc2c)
SSDB
Motif
Pfam: CAP-ZIP_m
Other DBs
NCBI-GeneID: 297530
NCBI-ProteinID: NP_954677
RGD: 735230
Ensembl: ENSRNOG00000011653
Vega: OTTRNOG00000002038
UniProt: Q80X08
Position
4
AA seq 1328 aa
MNRTSPDSEQPPASEPVWERPWSVEEIRRSSQNWSLAADAGLLQFLQEFSQQTISRTHEI
KKQVDGLIQETKATHCRLHNVFNDFLMLSNTQFIENRVYDEEVEDQALKTEAEKAEQEKT
REQKEIDLIPKVQEAVNYGLQVLDSAFEQLDIKAGNSDSEEEDANERVELILEPKDLYID
RPLPYLIGSKLFMEQEDVGLGELSSEEGSVGSDRGSIVDSEDEKEEEESDDFASHSDNEQ
NQHITQMSDEEEDDDADLFADSEKEGDDIEDIEESAKSKRPTSFADELAARIKGDVSNQR
KEGHTDGKPQRTVKEKKERRTPADDEEDILFPPPTLTDEDFSPFGSRGGLFSDRQGLFDD
DDESDLFKEAPRGQPAQGPVSEESPPSPKPGKKIPAGAVSVFLGYTDVSGSTSAPSLKEF
QKHEQSTPGKGPHLPAPTGLFDDDDNDSDEDDNFFMPSSSKPSKTDKVKPTTIIFDDDEG
DLFKEKTTALPAASVSQTDENKARTDKTITLPSSKNPKLVSETKTQKGLFSDEEDSEDLF
SSQSSSKTKSASVLSSQPPASVSLFGDEDEEDNLFGSAAAKKQTSSLPPQSQEKAKPSEQ
PPKKASALFSSDEEDQWSVADSQTKLASERKSKGERWDAGTNQGQEAKAVKKTNLFEEED
DDGVDLFAIAKDSQKKTQRTSLLFEDDTDSGSSLFSLPPTSVPPAATKKESIPKVPLLFS
DEEDSEVPSGVKPVDLKAENAAASPEVGSADVANVAQKEGLLPTSDQEAGGPSDIFSSSS
PLDKGAKGRTKTVLSLFDEDEDKVEDDSNTCAPQGGLEKGAKTDRRPKSTGVFQDEELLF
SHKLQKDNDPDVDLFAGTKKTRLSMPSGGSLFGDDDDDDLFSTAKTQPAQPVVPEKKGTL
RKDHKPPELTEGSKEKSTWKAETAQDSSGLTPFKSREPSSRIGKIQANLAINPATLLPSV
APQIPGAKPASSELAFPSSEPARSHIREAVPTLPGSEEAGVSFDLPAQADTLHSANKGRV
KVRGKRRPQTRAARRLAAQESSEAEDVIIDRGPVTQLSSSPVLPNGHQPLLQPRMASGET
SSEKAMAVPWEGGPVLSAVDRSFFVKSLPQTGNEAHLFDSGDIFPKSTGSQSMEGASVKA
GETPAHSSAGRKEKSLVFPDLSEASGVDDLFQSAKPRPTKKRNPFPLLEDEEDLFADQKG
KKNQWKSDSHQDVVSKTQDIFEDDIFATEAIKKPFPKKREKERTLEPNLFDDNIDIFADL
TVKPKEKPKKKVTAKSMFDDDTDDIFSSGLQAKASKPKSQSAEAASELRSENQVSNIFDD
PLNAFGSQ
NT seq 3987 nt   +upstreamnt  +downstreamnt
atgaaccggacgagccccgactcggagcagcctccggcgtccgaacccgtgtgggaacgg
ccctggtcggtggaggagatccgccgcagcagtcagaactggtcgctggcggctgacgct
ggtcttctacagtttctacaggagttctcacagcagactatctccaggactcacgaaatc
aagaagcaggtggatggattaattcaggagaccaaggccacacattgtcgtctgcataat
gtcttcaacgacttcctcatgctgtctaacacccagttcattgagaatcgggtgtacgat
gaggaagtggaggatcaggcgctcaagacggaggcggaaaaagctgagcaggagaagact
cgggaacagaaagaaatagatctgattcctaaagtccaggaggctgtgaactatgggtta
caggtcctggatagtgcgtttgagcaacttgacataaaagcagggaattcggactctgaa
gaggaagatgccaatgagcgggtggaattgatccttgagccaaaggacctctacattgac
cggcctttgccctacctcatcgggtcgaagctcttcatggaacaggaagacgtggggctt
ggagagctgtccagcgaagaaggctctgtgggcagtgaccgcgggagcattgtggacagt
gaagatgagaaagaagaggaggagtcagatgattttgccagtcatagtgacaatgaacaa
aaccagcatatcacacagatgagtgacgaagaagaggatgatgatgctgacctctttgct
gactctgagaaggagggggatgatatcgaggatattgaggaaagtgctaagtctaaaaga
cctacgtcttttgcggatgagctggctgctcggatcaaaggagatgtctcaaaccagcgg
aaagagggacacacagatggaaagcctcagaggacagtgaaggagaagaaggaaaggaga
acccctgcagatgatgaggaagacatcttgttcccaccccccacgctgactgatgaagac
ttctcaccgtttggctctagaggtggtctgttcagtgatcggcaggggctttttgatgat
gatgatgagagtgacctcttcaaggaagctccccgggggcagccagcccaaggtcctgtc
agtgaagaatcacctccatcccctaaacctggaaagaaaatcccagcaggggctgtttct
gtatttttagggtatactgatgtgtctgggtccacctctgccccatcactgaaggagttc
cagaaacatgagcagtccactccagggaagggcccacatttgccagctcctactggcctc
tttgatgatgatgataacgacagtgatgaagatgataacttttttatgccatcttctagc
aagccttctaagaccgacaaagtcaagcccaccaccattatctttgatgatgacgaagga
gatctgtttaaagaaaaaacaacagctttgccagcagcttctgtcagccagacagatgaa
aacaaagcacggacagataaaacgatcaccttaccttctagcaaaaatccgaagcttgta
tcagaaacaaagactcagaaaggtttgttttcagatgaagaagactctgaggatttgttt
tcttctcaaagttcaagtaagacgaaaagtgcatcagttctgtccagccaacccccagca
tcggtctccctttttggtgatgaagatgaagaggacaatctttttgggagtgcagcagct
aagaagcagacttcatctctgccacctcagagtcaagagaaagcaaaaccttcagagcag
cccccaaagaaagcatctgccttgttcagcagtgacgaggaggaccagtggagtgttgct
gattcacagaccaagttagcctccgagagaaagtccaaaggagagaggtgggacgcgggg
accaaccaaggccaagaagcgaaggctgtgaaaaagaccaatctctttgaggaggaggat
gatgatggagtcgatctctttgctattgcgaaggacagccaaaagaagactcagagaacc
tcacttctgtttgaagatgacactgatagcggaagctctctgttcagccttcctcctaca
tctgttcctcctgcagcaacgaaaaaagagagcatccccaaggtgccgttgttgtttagt
gatgaagaggacagtgaggtaccatctggtgtgaaacctgtggatctgaaggctgagaat
gccgcggcgtccccagaggtggggagtgctgatgtggccaatgtggcacagaaggaagga
cttttacccacatctgatcaggaagcaggcgggccttctgatatattttcttcttcatct
ccactggacaaaggagccaagggtaggaccaaaactgtccttagtttgtttgatgaggac
gaggacaaagtagaagatgacagcaacacctgtgcgccacaaggtggactggaaaagggt
gccaaaactgaccgccgccctaagagcacaggagtctttcaggatgaagagctgcttttc
agccacaagctgcaaaaggacaacgacccagatgttgatcttttcgctggtaccaaaaaa
accaggttgtccatgccaagtggggggagcctctttggtgatgacgacgatgatgatctc
ttcagcactgccaagactcagcctgcacagcctgtggtaccagaaaaaaaaggaacactg
agaaaagaccacaaacctcctgaattgactgaaggtagcaaagagaaaagcacatggaaa
gcagaaacggcccaggattcttcaggtctcactccatttaaaagcagagagccatccagt
cgcatcgggaaaatacaagcaaatttagcaattaacccagccactttgctgccctcagtg
gctccgcagatccccggagcaaagcctgcttcgtctgaactagcttttccttcatctgag
cctgcaaggagccacatccgggaagctgtgcccactcttcctgggagtgaggaggctggt
gtgagtttcgatcttcctgcccaggcagacaccttacacagtgcaaacaagggtcgtgtc
aaagtgagaggaaagaggagaccacagacccgtgctgctcggcggctggctgcccaggag
tccagcgaggctgaggacgtgatcattgatagaggacctgttacacagttgagcagtagt
cctgtcttaccaaacggccatcaacctcttctgcagcctaggatggccagtggagagacc
agctctgaaaaagccatggccgtaccttgggaaggtggtcctgttttatctgcagtggac
agaagcttctttgtaaagtctctgcctcagactggaaatgaggcccacctgtttgattct
ggggacattttccccaagagcacaggatcacagtccatggagggagcaagtgtcaaggca
ggggagaccccagcccactcgtcagcagggcggaaggagaagagcctggtatttcctgat
cttagtgaggccagcggtgtcgatgaccttttccagtctgccaagccaagaccaacaaag
aaaagaaaccctttccccctccttgaagatgaggaggacctctttgcagatcagaaaggc
aaaaagaatcagtggaaatctgacagccatcaggacgttgtgtcaaaaactcaagacatc
tttgaggatgatatatttgctacggaagcaattaagaagccttttccaaaaaaaagagag
aaggagagaactttggaacccaacttatttgatgataatattgatatcttcgctgacttg
actgtgaaacccaaagaaaagcccaaaaagaaagtcacagccaagtccatgtttgacgat
gatacagatgatattttctcctctggcctccaggctaaagcatctaaacccaaaagccaa
tctgctgaggcagcatctgaattaaggtctgagaaccaagtgtccaacatttttgatgac
cctctgaatgcctttggaagccagtag

DBGET integrated database retrieval system