KEGG   Rattus norvegicus (rat): 297530
Entry
297530            CDS       T01003                                 

Gene name
Washc2c, Fam21, Fam21c, NP61201
Definition
(RefSeq) WASH complex subunit 2C
  KO
K18462  WASH complex subunit FAM21
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    297530 (Washc2c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    297530 (Washc2c)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Others
   WASH complex
    297530 (Washc2c)
SSDB
Motif
Pfam: CAP-ZIP_m
Other DBs
NCBI-GeneID: 297530
NCBI-ProteinID: NP_954677
RGD: 735230
Ensembl: ENSRNOG00000011653
Vega: OTTRNOG00000002038
UniProt: Q80X08
Position
4q42
AA seq 1328 aa
MNRTSPDSEQPPASEPVWERPWSVEEIRRSSQNWSLAADAGLLQFLQEFSQQTISRTHEI
KKQVDGLIQETKATHCRLHNVFNDFLMLSNTQFIENRVYDEEVEDQALKTEAEKAEQEKT
REQKEIDLIPKVQEAVNYGLQVLDSAFEQLDIKAGNSDSEEEDANERVELILEPKDLYID
RPLPYLIGSKLFMEQEDVGLGELSSEEGSVGSDRGSIVDSEDEKEEEESDDFASHSDNEQ
NQHITQMSDEEEDDDADLFADSEKEGDDIEDIEESAKSKRPTSFADELAARIKGDVSNQR
KEGHTDGKPQRTVKEKKERRTPADDEEDILFPPPTLTDEDFSPFGSRGGLFSDRQGLFDD
DDESDLFKEAPRGQPAQGPVSEESPPSPKPGKKIPAGAVSVFLGYTDVSGSTSAPSLKEF
QKHEQSTPGKSPHLPAPTGLFDDDDNDSDEDDNFFMPSSSKPSKTDKVKPTTIIFDDDEG
DLFKEKTTALPAASVSQTDENKARTDKTITLPSSKNPKLVSETKTQKGLFSDEEDSEDLF
SSQSSSKTKSASVLSSQPPASVSLFGDEDEEDNLFGSAAAKKQTSSLPPQSQEKAKPSEQ
PPKKASALFSSDEEDQWSVADSQTKLASERKSKGERWDAGTNQGQEAKAVKKTNLFEEED
DDGVDLFAIAKDSQKKTQRTSLLFEDDTDSGSSLFSLPPTSVPPAATKKESIPKVPLLFS
DEEDSEVPSGVKPVDLKAENAAASPEVGSADVANVAQKEGLLPTSDQEAGGPSDIFSSSS
PLDKGAKGRTKTVLSLFDEDEDKVEDDSNTCAPQGGLEKGVKTDRRPKSTGVFQDEELLF
SHKLQKDNDPDVDLFAGTKKTRLSMPSGGSLFGDDDDDDLFSTAKTQPAQPVVPEKKGTL
RKDHKPPELTEGSKEKSTWKAETAQDSSGLTPFKSREPSSRIGKIQANLAINPATLLPSV
APQIPGAKPASCELAFPSSEPARSHIREAVPTLPGSEEAGVSFDLPAQADTLHSANKGRV
KVRGKRRPQTRAARRLAAQESSEAEDVTIDRGPVTQLSSSPVLPNGHQPLLQPRMASGET
SSEKAMAVPWEGGPVLSAVDRSFFVKSLPQTGNEAHLFDSGDIFPKSTGSQSMEGASVKA
GETPAHSSAGRKEKSLVFPDLSEASGVDDLFQSAKPRPTKKRNPFPLLEDEEDLFADQKG
KKNQWKSDSHQDVVSKTQDIFEDDIFATEAIKKPFPKKREKERTLEPNLFDDNIDIFADL
TVKPKEKPKKKVTAKSMFDDDTDDIFSSGLQAKASKPKSQSAEAVSELRSENKVSNIFDD
PLNAFGSQ
NT seq 3987 nt   +upstreamnt  +downstreamnt
atgaaccggacgagcccggactcggagcagcctccggcgtccgaacccgtgtgggaacgg
ccctggtcggtggaggagatccgccgcagcagtcagaactggtcgctggcggctgacgct
ggtcttctacagtttctacaggagttctcacagcagactatctccaggactcacgaaatc
aagaagcaggtggatggattaattcaggagaccaaggccacacattgtcgtctgcataat
gtcttcaacgacttcctcatgctgtctaacacccagttcattgagaatcgggtgtacgat
gaggaagtggaggatcaggcgctcaagacggaggcggaaaaagctgagcaggagaagact
cgggaacagaaagaaatagatctgattcctaaagtccaggaggctgtgaactatgggtta
caggtcctggatagtgcgtttgagcaacttgacataaaagcagggaattcggactctgaa
gaggaagatgccaatgagcgggtggaattgatccttgagccaaaggacctctacattgac
cggcctttgccctacctcatcgggtcgaagctcttcatggaacaggaagacgtggggctt
ggagagctgtccagcgaagaaggctctgtgggcagtgaccgcgggagcattgtggacagt
gaagatgagaaagaagaggaggagtcagatgattttgccagtcatagtgacaatgaacaa
aaccagcatatcacacagatgagtgacgaagaagaggatgatgatgctgacctctttgct
gactctgagaaggagggggatgatatcgaggatattgaggaaagtgctaagtctaaaaga
cctacgtcttttgcggatgagctggctgctcggatcaaaggagatgtctcaaaccagcgg
aaagagggacacacagatggaaagcctcagaggacagtgaaggagaagaaggaaaggaga
acccctgcagatgatgaggaagacatcttgttcccaccccccacgctgactgatgaagac
ttctcaccgtttggctctagaggtggtctgttcagtgatcggcaggggctttttgatgat
gatgatgagagtgacctcttcaaggaagctccccgggggcagccagcccaaggtcctgtc
agtgaagaatcacctccatcccctaaacctggaaagaaaatcccagcaggggctgtttct
gtatttttagggtatactgatgtgtctgggtccacctctgccccatcactgaaggagttc
cagaaacatgagcagtccactccagggaagagcccacatttgccagctcctactggcctc
tttgatgatgatgataacgacagtgatgaagatgataacttttttatgccatcttctagc
aagccttctaagaccgacaaagtcaagcccaccaccattatctttgatgatgacgaagga
gatctgtttaaagaaaaaacaacagctttgccagcagcttctgtcagccagacagatgaa
aacaaagcacggacagataaaacgatcaccttaccttctagcaaaaatccgaagcttgta
tcagaaacaaagactcagaaaggtttgttttcagatgaagaagactctgaggatttgttt
tcttctcaaagttcaagtaagacgaaaagtgcatcagttctgtccagccaacccccagca
tcggtctccctttttggtgatgaagatgaagaggacaatctttttgggagtgcagcagct
aagaagcagacttcatctctgccacctcagagtcaggagaaagcaaaaccttcagagcag
cccccaaagaaagcatctgccttgttcagcagtgacgaggaggaccagtggagtgttgct
gattcacagaccaagttagcctccgagagaaagtccaaaggagagaggtgggacgcgggg
accaaccaaggccaagaagcgaaggctgtgaaaaagaccaatctctttgaggaggaggat
gatgatggagtcgatctctttgctattgcgaaggacagccaaaagaagactcagagaacc
tcacttctgtttgaagatgacactgatagcggaagctctctgttcagccttcctcctaca
tctgttcctcctgcagcaacgaaaaaagagagcatccccaaggtgccgttgttgtttagt
gatgaagaggacagtgaggtaccatctggtgtgaaacctgtggatctgaaggctgagaat
gccgcggcgtccccagaggtggggagtgctgatgtggccaatgtggcacagaaggaagga
cttttacccacatctgatcaggaagcaggcgggccttctgatatattttcttcttcatct
ccactggacaaaggagccaagggtaggaccaaaactgtccttagtttgtttgatgaggac
gaggacaaagtagaagatgacagcaacacctgtgcgccacaaggtggactggaaaagggt
gtcaaaactgaccgccgccctaagagcacaggagtctttcaggatgaagagctgcttttc
agccacaagctgcaaaaggacaacgacccagatgttgatcttttcgctggtaccaaaaaa
accaggttgtccatgccaagtggggggagcctctttggtgatgacgacgatgatgatctc
ttcagcactgccaagactcagcctgcacagcctgtggtaccagaaaaaaaaggaacactg
agaaaagaccacaaacctcctgaattgactgaaggtagcaaagagaaaagcacatggaaa
gcagaaacggcccaggattcttcaggtctcactccatttaaaagcagagagccatccagt
cgcatcgggaaaatacaagcaaatttagcaattaacccagccactttgctgccctcagtg
gctccgcagatccccggagcaaagcctgcttcgtgtgaactagcttttccttcatctgag
cctgcaaggagccacatccgggaagctgtgcccactcttcctgggagtgaggaggctggt
gtgagtttcgatcttcctgcccaggcagacaccttacacagtgcaaacaagggtcgtgtc
aaagtgagaggaaagaggagaccacagacccgtgctgctcggcggctggctgcccaggag
tccagcgaggctgaggacgtgaccattgatagaggacctgttacacagttgagcagtagt
cctgtcttaccaaacggccatcaacctcttctgcagcctaggatggccagtggagagacc
agctctgaaaaagccatggccgtaccttgggaaggtggtcctgttttatctgcagtggac
agaagcttctttgtaaagtctctgcctcagactggaaatgaggcccacctgtttgattct
ggggacattttccccaagagcacaggatcacagtccatggagggagcaagtgtcaaggca
ggggagaccccagcccactcgtcagcagggcggaaggagaagagcctggtatttcctgat
cttagtgaggccagcggtgtcgatgaccttttccagtctgccaagccaagaccaacaaag
aaaagaaaccctttccccctccttgaagatgaggaggacctctttgcagatcagaaaggc
aaaaagaatcagtggaaatctgacagccatcaggacgttgtgtcaaaaactcaagacatc
tttgaggatgatatatttgctacggaagcaattaagaagccttttccaaaaaaaagagag
aaggagagaactttggaacccaacttatttgatgataatattgatatcttcgctgacttg
actgtgaaacccaaagaaaagcccaaaaagaaagtcacagccaagtccatgtttgacgat
gatacagatgatattttctcctctggcctgcaggctaaagcatctaaacccaaaagccaa
tctgctgaggcagtatctgaattaaggtctgagaacaaagtgtccaacatttttgatgac
cctctgaatgcctttggaagccagtag

DBGET integrated database retrieval system