KEGG   Rattus norvegicus (rat): 297566
Entry
297566            CDS       T01003                                 

Gene name
Atp6v1e1, Atp6e, Atp6e2, P31, Vma4
Definition
(RefSeq) ATPase H+ transporting V1 subunit E1
  KO
K02150  V-type H+-transporting ATPase subunit E
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04150  mTOR signaling pathway
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    297566 (Atp6v1e1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    297566 (Atp6v1e1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    297566 (Atp6v1e1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    297566 (Atp6v1e1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    297566 (Atp6v1e1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    297566 (Atp6v1e1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    297566 (Atp6v1e1)
SSDB
Motif
Pfam: vATP-synt_E DUF4288 NifW OmpH
Other DBs
NCBI-GeneID: 297566
NCBI-ProteinID: NP_942040
RGD: 735157
Ensembl: ENSRNOG00000011905
UniProt: Q6PCU2
Position
4q42
AA seq 226 aa
MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKK
EKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLV
LQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKKDVDVQIDLEAYLPEDIAGG
VEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
NT seq 681 nt   +upstreamnt  +downstreamnt
atggcgctcagcgatgcagatgtacagaagcagattaagcacatgatggctttcatcgaa
caagaagccaatgagaaagcagaagaaatcgatgcaaaggcagaagaagagttcaacatt
gagaaaggtcgtcttgtgcaaacccagagattgaagattatggaatactatgagaagaag
gaaaagcagatcgagcagcagaagaaaattcaaatgtccaacttgatgaatcaagcaaga
ctcaaagtcctcagagcaagagatgacctcatcactgatctgctgaatgaggcaaaacag
agactcagcaaggtggtaaaagatacgaccaggtaccaggtgctgctggatgggctggtc
ctccagggcttgtaccagctgttggaacctcgaatgattgtgcgctgcagaaaacaagat
ttccctttggtgaaggctgcagtacagaaagcaatacctatgtataaaattgccaccaaa
aaagatgttgacgtccagattgacctggaggcctacctgcctgaggacatagctggtgga
gttgaaatctataatggggaccgcaagataaaggtttccaacactctggaaagccgactg
gacctaatagcccagcagatgatgccagaagtccgcggagccttgtttggtgcaaatgcc
aataggaagtttctggactga

DBGET integrated database retrieval system