KEGG   Rattus norvegicus (rat): 29757Help
Entry
29757             CDS       T01003                                 

Gene name
Atp6v0a1, Atp6n1, Atp6n1a
Definition
(RefSeq) ATPase H+ transporting V0 subunit a1
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04142  Lysosome
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05152  Tuberculosis
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    29757 (Atp6v0a1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    29757 (Atp6v0a1)
   04142 Lysosome
    29757 (Atp6v0a1)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    29757 (Atp6v0a1)
  Nervous system
   04721 Synaptic vesicle cycle
    29757 (Atp6v0a1)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    29757 (Atp6v0a1)
  Infectious diseases
   05152 Tuberculosis
    29757 (Atp6v0a1)
   05165 Human papillomavirus infection
    29757 (Atp6v0a1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   29757 (Atp6v0a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V_ATPase_I
Motif
Other DBs
NCBI-GeneID: 29757
NCBI-ProteinID: NP_113792
RGD: 68405
Ensembl: ENSRNOG00000036814
UniProt: P25286 Q2I6B5
Position
10q31
AA seq 838 aa AA seqDB search
MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEE
MDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKR
NFLELTELKFILRKTQQFFDEMADPDLLEESSSLLEPNEMGRGAPLRLGFVAGVINRERI
PTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRVKKICEGF
RASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKM
KAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQT
PPTYNKTNKFTHGFQNIVDAYGIGTYREINPAPYTVITFPFLFAVMFGDFGHGILMTLFA
VWMVLRESRILSQKNENEMFSMVFSGRYIILLMGLFSIYTGLIYNDCFSKSLNIFGSSWS
VRPMFTIGNWTEETLLGSSVLQLNPAIPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKM
SVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMSSLFGYLVILIFYKWTAYDA
HSSRNAPSLLIHFINMFLFSYPESGNAMLYSGQKGIQCFLIVVAMLCVPWMLLFKPLILR
HQYLRKKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH
QAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLHVRSLAGGLGLFFIF
AAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYTGTGFKFLPFSFEHIREGKFDE
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atgggggagcttttccgaagcgaggagatgaccctggcccagctctttctccagtccgaa
gctgcttattgttgtgtcagtgaattaggagaacttggaaaggttcagttccgggattta
aatccagatgtgaatgttttccagaggaaatttgtgaatgaagttagaagatgtgaagaa
atggatcgaaaactccggtttgttgagaaagagataagaaaagctaacatcccaattatg
gacactggagagaacccggaggtgccctttcccagggacatgatcgacttggaggccaat
ttcgagaagatcgaaaacgaactgaaggaaatcaacactaaccaggaagctctaaagcga
aacttcctggaactgactgaattaaaatttatactgcgcaaaactcagcagtttttcgat
gagatggcggatccagacctgttggaagagtcctcatcactcttggagccaaacgagatg
ggaagaggcgcgcctttacgacttggcttcgtagctggtgtgattaaccgggaacggatc
ccgacctttgagcgcatgctttggcgagtgtgccgagggaatgtgttcctgagacaggct
gaaatcgaaaacccgctggaggatcccgtgactggcgactacgtgcacaagtccgtgttc
atcatttttttccaaggtgaccagctgaaaaacagggtcaagaaaatctgtgaagggttc
cgagcctccctctatccctgtcctgagactccacaggagagaaaagaaatggcttccgga
gtcaataccaggatcgacgatctccaaatggttctgaatcagacagaggaccaccgccag
agggttctgcaggcggctgctaagaacatccgggtgtggttcatcaaggtgcggaagatg
aaagctatctaccataccctgaacctctgcaacatcgatgtgacgcagaagtgcctgatc
gcggaagtctggtgccccgtcactgacctggactccatccagtttgcactgcgaaggggc
acggagcacagcggttccactgtcccctccattctgaacaggatgcagacaaaccagaca
cccccgacgtataacaaaaccaacaagttcacgcacggcttccagaacatagtggatgct
tatgggatcggcacttaccgagaaattaacccagctccgtacaccgtcatcaccttcccc
tttctgtttgctgtgatgtttggagattttgggcacggcattttgatgactctgtttgct
gtgtggatggtgttgagggagagccggatcctctcccagaagaacgagaatgagatgttt
agcatggtgttcagcggccgatacattatccttctgatgggactgttctccatctacact
ggactcatctacaatgactgcttttccaagtctctgaatatctttgggtcatcatggagc
gtacggccaatgttcaccatagggaactggacggaggagacgctcctggggagttctgtc
ctccagctgaacccagctatccctggagtctttggtggcccttacccatttggcattgat
ccgatttggaacatcgcaaccaacaagctgaccttcctcaactccttcaagatgaagatg
tcagttattcttgggatcatccacatgctgttcggggtcagcctgagccttttcaaccac
atctatttcaagaagcccctgaacatctactttggctttattcccgagataatcttcatg
tcctcgctgtttggctacctggtcatcctcatcttttacaagtggacagcctacgatgcc
cactcgtctagaaatgccccgagcctcctgatccatttcataaacatgttcctcttctcc
tacccagagtctggtaacgcaatgctgtactctggacagaaaggaattcagtgtttcctc
atagtggtggcaatgctctgtgtcccctggatgctgctgtttaagccgttgatccttcgc
catcagtacctgaggaagaagcatttgggaactctcaactttggtgggatcagggtgggc
aacggaccgacagaggaggatgctgaaattattcagcatgaccagctctccacccattca
gaggacgcagaagagcctaccgaggacgaagtgtttgactttggcgacaccatggtccac
caggccatccacaccattgagtactgcttgggctgcatctccaacactgcgtcctacctg
cggctctgggccctcagcctggcccatgcacagctctctgaagtactctggaccatggtg
atccacatcggcctgcatgtccggagtctggcagggggactggggctgtttttcatcttc
gctgcctttgccaccctgaccgtggccatcctgctgatcatggaaggcctctcagccttc
ctccacgcactgcgattacactgggtggaattccagaacaaattctacactgggactggt
ttcaagttcctccccttctcctttgagcacattcgggaagggaagtttgatgagtga

DBGET integrated database retrieval system