KEGG   Rattus norvegicus (rat): 297597Help
Entry
297597            CDS       T01003                                 

Gene name
Ing4
Definition
(RefSeq) inhibitor of growth family, member 4
  KO
K11346  inhibitor of growth protein 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    297597 (Ing4)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    HBO1 complex
     297597 (Ing4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ING PHD Spc7 PHD_2 zf-HC5HC2H HCMV_UL139 FlxA DUF1192 LMBR1
Motif
Other DBs
NCBI-GeneID: 297597
NCBI-ProteinID: NP_001073356
RGD: 1309407
Ensembl: ENSRNOG00000023363
UniProt: A1L130
Position
4q42
AA seq 245 aa AA seqDB search
MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEE
KLALLRQIQEAYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSD
YDSSSSKGRTQKEKKAARARSKGKNSDEEAPKAAQKKLKLVRTSPEYGMPSVTFGSVHPS
DVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQ
ERKKK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgggatgtatttggaacattatctggacagtattgaaaacctcccgtttgaa
ttgcagagaaactttcagctcatgagggacctagaccaaaggacagaggacctgaaggct
gaaattgacaagttggccactgaatatatgagtagcgcccgcagcctgagctccgaggaa
aaactggcccttctcagacagatccaggaggcctatggcaaatgcaaggaatttggtgac
gacaaggtgcagctggccatgcagacctatgagatggtggacaaacacattcggcggctg
gacacagacctggcccgttttgaggctgatctgaaggaaaaacagatcgagtcaagtgac
tatgacagctcttccagcaaaggccggacccaaaaggagaaaaaagctgcccgtgcccgt
tccaaagggaaaaactcagatgaagaagcccccaaggctgcccagaaaaagttaaaactt
gtgcgcacaagtcctgagtatgggatgccctcagtgacctttggcagtgtccacccctct
gatgtgttggatatgcctgtggatcccaacgaacccacatattgcctttgtcaccaggtc
tcctatggagagatgattggctgtgacaacccagactgttccattgagtggttccacttt
gcctgtgtggggctgacaaccaagcctcgagggaaatggttttgcccacgctgctcccaa
gaacggaagaagaaatag

DBGET integrated database retrieval system