KEGG   Rattus norvegicus (rat): 297602Help
Entry
297602            CDS       T01003                                 

Gene name
Tapbpl
Definition
(RefSeq) TAP binding protein-like
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: V-set ig C1-set Ig_3 I-set Izumo-Ig V-set_CD47
Motif
Other DBs
NCBI-GeneID: 297602
NCBI-ProteinID: NP_001100092
RGD: 1307893
Ensembl: ENSRNOG00000027552
UniProt: D4A6L1
Position
4q42
AA seq 446 aa AA seqDB search
MGWEPSWCLLLCLAVSGAAGTDPPTEERRWQAVDIVLDCFLVTEDKHRGAFGSSEDREKA
LLVLKQVPVLDDGSLEGFTDFQGSAEARQDSPIIFEASVDLVQIPQAEALLHADCSGKAV
TCEIAQYFLQARQEATFEKADWFISNMQVSRGGPSVSIVMKTLRDDEAGAVRHPSLNIPL
SPQGTVKTKVEFQVTAETQTLNQLLGSSVSLPCRFSMAPGLDLTGVEWRLQHKGSGQLVY
SWKTGQGQAKRKGATLKPEKLLRAGDASLTLPNLTLKDEGNYICQISTSLYQAQQIVPLN
ILASPKVQLILANKDPLPSLICSIAGYYPLDVVVTWIREELGGIPAQVSGASFSSLRQNM
MGTYSISSTVTAEPGPTGATYTCQVAHVSLEEPLTVSMRVLPNTEQRGALGVIVASILFL
FALLLLGLHRQQASSSKSTKSVRHSE
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgggctgggagcccagctggtgtctgctgctctgtttggctgtctctggggcggcaggg
actgaccccccgacagaagaaagacggtggcaggccgtggacatcgtcttagactgcttc
ttggtgacagaagacaagcatcgcggggcttttggcagcagtgaggacagggagaaggcc
ctgcttgtactgaagcaggtgccggtgctggatgatggttccctggagggcttcacagat
ttccaagggagcgcagaggccagacaagattcaccgattatctttgaggcgtccgtggac
ttggtacagattccccaggcagaggctttgctccacgctgactgcagcgggaaggcggtg
acctgtgagatcgcccagtatttcctccaggccagacaagaggccacttttgagaaagca
gattggttcatcagcaacatgcaggtttctagaggggggcccagtgtctccatagtgatg
aagactctaagagatgatgaagctggagctgtccggcacccttcgctgaacatacccctg
agcccccagggcacagtgaagactaaagtggagttccaggtgacagcagagacccaaacc
ctgaatcagctgctggggtcctctgtgtccctgccctgcaggttctccatggcaccaggc
ctggacctcaccggcgtggaatggaggctacagcataaaggcagtggccagctggtgtac
agctggaagacagggcaggggcaggctaagcgcaagggcgctacgctgaagcctgagaag
ctcctcagggcgggagatgcctctctcaccttacccaacctcactctgaaggatgagggg
aactatatctgccagatctctacctctctgtaccaagcccagcagatcgtgccgcttaac
atcctagcttcccccaaagtacagctgatcttggcaaacaaggatccactgccctccctc
atctgcagcattgctggctactaccctctggatgtggtggtgacgtggattcgagaagag
ctgggtggaattccagcccaagtctctggtgcctccttctccagcctcagacagaacatg
atgggaacctacagcatttcttccacggtgacagccgagccaggccccacaggtgccact
tacacctgccaagttgcccacgtctccctggaggagcccctgacagtcagcatgagggtt
ttgccaaacacagagcaaagaggagccttgggagtcatcgttgccagcatcctcttcctt
tttgcgctcttgctcctgggacttcatagacagcaagcttcatcatcaaagtccaccaag
tctgtgaggcactctgagtag

DBGET integrated database retrieval system