KEGG   Rattus norvegicus (rat): 297604
Entry
297604            CDS       T01003                                 

Gene name
Ltbr
Definition
(RefSeq) lymphotoxin beta receptor
  KO
K03159  lymphotoxin beta receptor TNFR superfamily member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04064  NF-kappa B signaling pathway
rno04066  HIF-1 signaling pathway
rno04672  Intestinal immune network for IgA production
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    297604 (Ltbr)
   04066 HIF-1 signaling pathway
    297604 (Ltbr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    297604 (Ltbr)
   04061 Viral protein interaction with cytokine and cytokine receptor
    297604 (Ltbr)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    297604 (Ltbr)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    297604 (Ltbr)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    297604 (Ltbr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    297604 (Ltbr)
Cytokine receptors [BR:rno04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   297604 (Ltbr)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 297604
NCBI-ProteinID: NP_001008316
RGD: 1309448
Ensembl: ENSRNOG00000019264
UniProt: Q5U2S8
Position
4q42
AA seq 416 aa
MRLPGASSPCGLVWGPLLLGFCGLLVASQPQLVPPYRIENQTCWDPDKEYYEPLHQVCCS
RCPPGKFVHAVCSPSQDTVCKTCLHNSYNEHWNHLFSCQLCRPCDSVLGFEEIAPCTSDR
KPECRCKPGMSCVYLDNECVHCEEERLVLCRPGTEAEVTDEIMDTEVNCVPCKPGHFQNT
SSPRARCQPHTRCESQGLVEAASGTSYSDTICKNPPEAAGTMLLLAILLSLVFFLLFTTV
LACAWMRHPSLCRKLGTLLKRHPEGEESPPCQPPRANPHFRDLAEPLLPMSGDLSPAPAG
PPTAPSLEEVVLQQQSPLIQARELEAEPGEHGQVAHGANGIHVTGGSVTVTGNIYIYNGP
VLGGTRGPGDPPAPPEPPYPTPEEGAPGPSELSTPYQEDGKAWHLAETETLGCQDL
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgcgcctgcctggggcctcctctccctgcggcctggtctggggaccactcctgctggga
ttctgcgggctcctggtggcctctcagccccagctggtgcccccatatcgcatagaaaac
caaacttgctgggacccggacaaggaatactacgagcctctgcatcaagtctgctgctcc
cgctgtcccccaggcaagtttgtccatgctgtctgcagccccagccaagacacggtttgc
aagacttgcctccataattcctacaacgaacactggaaccatctcttctcctgccagctg
tgccgcccctgtgactctgtgctgggcttcgaggagattgccccctgcaccagcgatcgg
aaacccgagtgccgctgcaagccggggatgtcctgcgtgtatttggacaatgagtgtgtg
cactgtgaggaggagcggcttgtactctgccggcctggcacagaagctgaggtcacagat
gaaattatggatactgaagtcaactgtgtcccctgtaagccaggacacttccagaacacg
tcctcccccagagcccgctgtcaaccccacaccaggtgtgagagccagggcctggtggag
gcagcttcaggtacctcgtactctgacaccatctgtaaaaatccacccgaggcagcagga
acaatgctgctactagccatcctgctgtcgctggtcttctttctgcttttcaccactgtc
ctggcctgtgcctggatgaggcacccttccctctgcagaaagctgggtactctgctcaag
aggcatccagagggagaagaatctcccccctgccagcctccaagagccaacccacatttc
cgtgacctggcagagccactcctacccatgtctggagacttgtccccagcccctgctgga
cccccaacggccccctccttggaggaagtggtgctacagcagcagagtcccctgatccag
gccagggagctggaggctgagcctggggaacatggccaggtggcccacggtgcgaatggc
attcacgtgaccggaggctctgtgactgtcaccggcaatatctacatatacaatgggcca
gtgctggggggaacacggggccctggagaccctccagctccccctgagcctccatacccg
actcccgaagagggagcgcctggcccctctgagctgtctacaccctaccaggaggatggc
aaagcttggcatctggctgagacagagacactagggtgccaagacctctga

DBGET integrated database retrieval system