KEGG   Rattus norvegicus (rat): 297645
Entry
297645            CDS       T01003                                 

Gene name
Klre1
Definition
(RefSeq) killer cell lectin-like receptor, family E, member 1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Lectin_C DUF1218 UL45 DUF2721
Other DBs
NCBI-GeneID: 297645
NCBI-ProteinID: NP_852037
RGD: 727903
Ensembl: ENSRNOG00000058714
UniProt: Q80ZC8
Position
4q42
AA seq 226 aa
MNQTLIICSTLNVNSQQKSKAKNSMKNTFHSNELSSIEQRQKYQKHLKKDKKTAEDITGV
GNCSPPWRLISSVLFVVCLLLMAVAMVMTIFTTRLSSERSSSNIHQEGLHHPCPENWVWF
RCSCYYFSKEKLVWRESQRACLSFNSSLIRMNKEEMDFFSLKSFFWVGVYYDETSKQWLW
DDHSVLPSGMFSGLESSPKNFCASYKSKEAYLAENCSTKLMYICKK
NT seq 681 nt   +upstreamnt  +downstreamnt
atgaatcaaacactcataatctgttctaccctaaatgttaattcccagcagaagagcaaa
gcaaaaaacagtatgaagaatacatttcattcaaatgaattgtcatccattgagcagagg
caaaaataccaaaaacatcttaagaaggacaaaaagacagcagaagacatcactggtgta
gggaattgctcccctccgtggaggctcatctctagtgtgctctttgtggtctgccttctc
ctgatggctgtagccatggtgatgaccattttcaccacaaggttatcttctgaaagatca
tcttctaatattcatcaggaaggactccatcatccctgcccagagaactgggtttggttc
aggtgcagctgttactacttctccaaggaaaagctagtttggagagagagtcagcgtgcc
tgcttgtccttcaattctagtctcataaggatgaacaaagaggagatggatttcttctct
ttgaagtctttcttttgggttggagtttactacgatgaaaccagcaaacagtggctgtgg
gacgaccattcagttctacccagtgggatgttttctggtcttgaatctagtccgaaaaac
ttctgtgcatcttataaatcaaaagaagcctatttggcagaaaactgttcaaccaaacta
atgtacatttgcaagaagtag

DBGET integrated database retrieval system