KEGG   Rattus norvegicus (rat): 297695
Entry
297695            CDS       T01003                                 

Gene name
Wbp11
Definition
(RefSeq) WW domain-binding protein 11
  KO
K12866  WW domain-binding protein 11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    297695 (Wbp11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    297695 (Wbp11)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    297695 (Wbp11)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     297695 (Wbp11)
Spliceosome [BR:rno03041]
 Complex B
  Other components
   Prp19 complex
    297695 (Wbp11)
SSDB
Motif
Pfam: Wbp11
Other DBs
NCBI-GeneID: 297695
NCBI-ProteinID: NP_001009661
RGD: 1307911
Ensembl: ENSRNOG00000049593
UniProt: Q5PQQ2
Position
4
AA seq 641 aa
MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKL
DEMEFNPVQQPQLNEKVLKDKRKKLRETFERILRLYEKENPDIYKELRKLEVEYEQKRAQ
LSQYFDAVKNAQHVEVESIPLPDMPHAPSNILIQDIPLPGAQPPSILKKTSAYGPPTRAV
SILPLLGHGVPRLPPGRKPPGPPPGPPPPQVLQMYGRKVGFALDLPPRRRDEDMLYSPEL
AQRGHDDDMSSTSEDDGYPEDMDQDKHDDSTEDSDTDRSDAESDGDEFGHRDDSERDNTE
EKKSGLSVRFADMPGKSRKKKKNMKELTPLQAMMLRMAGQEIPEEGREVEEFSEEEDDDD
SEDSEAEKPSQKQHKEDSHADGSSAASSQQQAPPQAVPPSQIQAPPMPGPPPLGPPPAPP
LRPPGPPTGLPPGPPPGAPPFLRPPGMPGIRGPLPRLLPPGPPPGRPPGPPPGPPPGLPP
GPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAPPSL
IQRPKADDASAATIEKKATATISAKPQITNPKAEVTRFVPTALRVRRENKGATAVPQRRS
EEDSAVPVAKAAPRSGPSVPVSVQTKDDVYEAFMKEMEGLL
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgggacgaagatcaacatcctccaccaagagtgggaagtttatgaaccccacagaccaa
gcccgaaaagaagcccggaaaagagagttgaaaaagaacaaaaaacagcgcatgatggtc
cgagctgcagttttgaagatgaaagaccccaagcagattatccgggacatggagaaattg
gatgaaatggagtttaacccagtgcaacagccgcagttgaatgaaaaagtactgaaagac
aagcgtaaaaagctgcgagaaacctttgaacgaattctgcggctctatgagaaagaaaac
ccagacatctacaaagagctgaggaagctggaagtggagtacgagcagaagagggcgcag
ctgagccagtactttgatgccgtcaagaacgcccagcatgtggaagtagagagcatccct
ctgccagatatgccgcatgccccttccaacatcctgatccaggacattcctcttcctggt
gcccagccaccctctatcctgaagaaaacctcggcatatgggcctccaactcgagcagtt
tctatccttcctctcctgggacacggtgttccacgtttgccccctggcagaaaaccgcct
ggccctccacctggcccacctcctcctcaagttctgcagatgtatggccgtaaagtgggc
tttgctctcgatcttccccctcggaggcgagatgaagacatgctgtacagtccggaactt
gctcagcggggccatgatgatgacatgtccagcaccagtgaggacgacggctatcctgag
gacatggatcaggataagcacgatgacagtactgaggacagtgacactgacagatccgat
gcagaaagtgatggggatgagttcggccaccgtgacgacagtgagcgtgacaacactgag
gagaagaagtcaggtctgagcgtccggtttgcagatatgcctgggaaatctaggaagaag
aagaagaacatgaaggagctgactcctcttcaagccatgatgctgcgaatggcaggtcag
gaaatccctgaggaaggacgggaagtggaggagttttcagaggaggaggacgacgacgac
tctgaggactctgaggcagagaagccatcgcagaagcagcataaagaggattcccacgct
gacggctcctcggccgcctcttcacagcagcaggcccctccacaggccgttcctccttct
cagatacaagcacctcccatgccaggaccgccacctctcggaccaccgcctgccccaccc
ttacggcctcctggaccacctacaggccttcctcctgggccacctccaggggctcctcca
ttcctgagaccacctgggatgccaggaatccgagggcctttaccacggcttttacctcca
ggaccaccaccaggccgacctcctggccctccgccaggcccacctccaggtctcccccct
gggccccctcctcgaggacccccaccaaggctacctcctcctgcacctccaggtatccct
cctcctcgtcctggcatgatgcgccctccgttggtgcctcctcttggacctgccccgcct
ggccttttcccgccagctcccttacccaacccaggggtgttgagtgccccacccagcctc
attcagcgaccgaaggcggatgatgcaagtgcagccaccatcgagaagaaggccacagcg
accatcagtgccaagccccagatcaccaatcccaaggcagaggtcacacggtttgtgccc
actgcactgagggtgcgccgcgagaataagggggctactgccgttccccaaagaaggtca
gaggaggactctgctgtgcctgtggccaaagcagcccccagatctgggccttcagttcct
gtgtcggtacagactaaggacgatgtctatgaagcgtttatgaaagagatggaagggctg
ctgtga

DBGET integrated database retrieval system