KEGG   Rattus norvegicus (rat): 297727Help
Entry
297727            CDS       T01003                                 

Gene name
Mrps35
Definition
(RefSeq) mitochondrial ribosomal protein S35
  KO
K17413  small subunit ribosomal protein S35
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    297727 (Mrps35)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    297727 (Mrps35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP-S28
Motif
Other DBs
NCBI-GeneID: 297727
NCBI-ProteinID: NP_001100098
RGD: 1306720
Ensembl: ENSRNOG00000001842
UniProt: D4A9Z6
Position
4q44
AA seq 320 aa AA seqDB search
MAAASLQLRLTLYPGARGLRTFSSVARPAAPRAGPRTVSRGERPMRRKALPPRTEKMETD
QDWPSVYPTAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNVELLKIPNFLHLTPVAIKRHC
GALKDFCTEWPAALDSDEKCEKHFPVEIDTADYVSSGPSIRNPRARAVTLRVKLSSLNLD
NHAKKKLIKLVGERYCKTTDVLTIKTDRCPLKRQNYDYAMYLLTVLYHESWKTEEWEKNK
TEEDMDEYVWAKSSSENSVLQTLLQMRAAESSVAPSREELLGTKEVEDYQKCVVRLKNEG
ENEASLAQYKESVKRLLNLA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgcttcgctgcagctaaggctgaccctatacccgggagcgcgcggcctgcgc
accttctcctcagtcgccaggcccgcggctccaagagccggcccgcgtacagtatccaga
ggtgaaaggccgatgagaagaaaggcactgcctcctaggacggagaagatggagactgac
caggactggcccagcgtttaccctactgctgcaccgtttaaaccctcggctgttcctcta
cctgttcgaatgggatatccagtgaagaagggtgtgcccatggcgaaggaggggaatgta
gagcttctaaagatcccaaattttctgcatttgactcctgtggcaattaaaaggcactgc
ggagctctaaaagatttctgcactgagtggccagctgcactcgacagtgatgagaaatgt
gagaagcattttccagtcgagattgacacagcggattatgtgtcatcaggaccgtccatt
cgaaaccccagagcgcgagcggtaactttaagggttaaactttccagtttgaatttagac
aatcatgcaaagaaaaaacttattaaacttgtaggcgagcggtactgcaagactactgat
gtgctcactatcaagacagacagatgccctttgaagcggcagaactatgactatgcaatg
tatctccttacagtcctgtaccatgaatcttggaaaactgaagaatgggaaaaaaataag
actgaggaagacatggatgagtatgtgtgggcgaagagctcctcggagaacagcgtcctc
cagaccctgctgcagatgagagctgccgagagcagtgtggcgccgagcagagaagagctg
ctggggactaaagaggtcgaagattaccagaagtgtgtcgttcgtctcaagaatgagggg
gagaacgaggcaagccttgctcagtacaaagagtctgtgaagagattattaaatttggcc
tga

DBGET integrated database retrieval system