KEGG   Rattus norvegicus (rat): 297755
Entry
297755            CDS       T01003                                 

Gene name
Rpl7
Definition
(RefSeq) ribosomal protein L7
  KO
K02937  large subunit ribosomal protein L7e
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    297755 (Rpl7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    297755 (Rpl7)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    297755 (Rpl7)
SSDB
Motif
Pfam: Ribosomal_L30_N Ribosomal_L30
Other DBs
NCBI-GeneID: 297755
NCBI-ProteinID: NP_001094004
RGD: 735169
Ensembl: ENSRNOG00000006992
UniProt: B0K031
Position
5q11
AA seq 260 aa
MEAVPEKKKKVAAAPGTLKKKKVPAVPETLKKKRRNFAELKVKRLRKKFALKTLRKARRK
LIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKV
LQLLRLRQIFNGTFVKLNKASVNMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIA
LTDNSLVARSLGKFGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFV
EGGDAGNREDQINRLIRRMN
NT seq 783 nt   +upstreamnt  +downstreamnt
atggaggctgtaccagagaagaaaaagaaggttgccgctgcgccaggaacccttaagaag
aaaaaggttcctgcggtgccagaaacccttaagaaaaagcgaaggaatttcgcagagttg
aaggtcaagcgcctgaggaagaagtttgccctgaagacactgcgaaaggcaaggaggaag
ctcatctatgagaaggcaaagcactatcacaaggagtacagacagatgtaccggactgag
attcgcatggctaggatggcgaggaaagctggcaacttctatgtgcccgcagaaccaaaa
ttggcctttgtcatcagaatccgaggtatcaatggagtgagcccaaaggtgcgcaaggtg
ctgcagctgctccgtctccggcagatcttcaatggcacctttgtgaagctcaacaaggct
tcagtgaacatgctgaggatcgtggagccctacattgcatgggggtaccccaacctgaag
tcagtaaacgagctcatctacaaacgaggctatggcaaaatcaataaaaagcgcattgcc
ttgacagataactccttggttgctcgatctcttggtaaatttggcatcatctgcatggag
gatctaattcatgagatctatacagttggaaaacgctttaaggaagcaaataacttcctg
tggcccttcaaactgtcttccccacgaggtggaatgaagaaaaagacaactcactttgta
gaaggtggagacgctggcaacagggaagaccagataaacaggcttattagacggatgaac
taa

DBGET integrated database retrieval system