KEGG   Rattus norvegicus (rat): 297758
Entry
297758            CDS       T01003                                 

Gene name
Terf1
Definition
(RefSeq) telomeric repeat binding factor 1
  KO
K11110  telomeric repeat-binding factor 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    297758 (Terf1)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomere proteins
    Shelterin complex
     297758 (Terf1)
SSDB
Motif
Pfam: TRF Myb_DNA-binding Myb_DNA-bind_6 Val_tRNA-synt_C Presenilin
Other DBs
NCBI-GeneID: 297758
NCBI-ProteinID: NP_001012482
RGD: 1311574
Ensembl: ENSRNOG00000007291
UniProt: Q5EB98
Position
5q11
AA seq 421 aa
MAGTVTSAAPGARSNAGGTSADSPEKEAARDDAELFDCRVQLGPPREEENAELVAEAEAV
AAGWMLDFLCLSLCRAFRDGRCEDFRQTRDSAEAIIHGLPSLTAYQLKTVYICQFLTRVA
AGKSLDAQFEVDERITPLESALMIWDSIEKEHDKLHEEIQNLIKIQAVAVCMEMGSFKEA
EEVFERIFGDPEFYTPLERKLLKIISQKDVFHVLFQRFSYNLMMEKIQSYVECVLNEKSS
TFLMKAATKVVENEKARTVASEDKAKATNTGTETEVNSNKGESVNGQQSVETESLVDTGS
SVRSHKNALSPLKSRRLQPDFNRNEARTGTLQCEIATKRNRRTSGGNRLRISKNQPDTNE
KHGRRKKQTWLWEEDRSLKCGVRKYGEGNWAKILSHYKFNNRTSVMLKDRWRTMRRLRLI
S
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggcggggactgtcacctcagcagctccgggcgcgcggagcaatgcgggcgggacaagc
gcggattctccagagaaggaggcggcgagagacgacgcagagttgttcgactgccgggtg
cagctggggcccccgagagaggaggagaacgcggagcttgtggccgaggcggaggccgtg
gctgcgggctggatgctcgacttcctctgcctgtctctgtgccgagcctttcgcgacggc
cgctgcgaggactttcgccagactcgtgacagcgccgaggctattattcatggactaccc
agtcttacagcttaccagttgaaaactgtatatatatgtcagtttttgacaagagttgca
gcaggaaagtctcttgatgcacagtttgaagttgatgagcggattacacccttggaatca
gccctgatgatttgggactcaattgaaaaagaacatgacaaacttcatgaagaaatacag
aatttaattaaaattcaggctgtagctgtgtgtatggaaatgggcagctttaaggaagca
gaagaagtgtttgaaagaatatttggtgacccagaattttacacgcctttagaaagaaaa
ttacttaagataatctctcaaaaagacgtcttccacgtcctttttcaacgcttcagttat
aacctcatgatggagaaaattcagagttatgtggagtgtgtgttaaatgagaaatcatca
actttcctaatgaaggcagcaacaaaagtagtggaaaatgaaaaagcaaggacagtagct
tcggaggataaagcaaaggccaccaacactggaacagaaacggaagttaactcgaataaa
ggagaaagtgttaatggccaacagtctgtagaaactgaatccttggtggatacaggatcc
tcagtaaggtctcacaagaatgccttatctccgttgaaaagcagacgtcttcagccagat
ttcaataggaatgaagcaagaacaggaactcttcagtgtgaaatagcaacaaaacgaaac
agaagaaccagtggagggaatagattacgtatttcaaagaatcagccggacactaatgaa
aaacatgggcgcaggaaaaaacagacatggctttgggaagaagacagaagtttgaagtgt
ggtgtaaggaaatatggagagggaaattgggctaaaatactatcccattataagttcaac
aaccgaacaagtgtcatgttaaaggatcggtggagaacgatgaggaggctaaggctcatt
agctga

DBGET integrated database retrieval system