KEGG   Rattus norvegicus (rat): 297805
Entry
297805            CDS       T01003                                 

Gene name
Sdr16c5, RGD1565999, Rdhe2
Definition
(RefSeq) short chain dehydrogenase/reductase family 16C, member 5
  KO
K15734  all-trans-retinol dehydrogenase (NAD+) [EC:1.1.1.105]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    297805 (Sdr16c5)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.105  all-trans-retinol dehydrogenase (NAD+)
     297805 (Sdr16c5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 297805
NCBI-ProteinID: NP_001100104
RGD: 1565999
Ensembl: ENSRNOG00000008871
UniProt: D3ZS85
Position
5q12
AA seq 309 aa
MPCNLESAKDLLVFLGKSLLSILEALLSHVISKPRKNVAGEVVLITGAGSGLGRLLALQF
ARLGSVLVLWDVNKETNEETRQIAQEAGAIRVHAYTCDCSQREEVYRVADQVKKEVGDVS
ILINNAGIVTGRKFLDCPDDLMEKSLDVNFKAHLWMYKAFLPAMIANNHGHLVCISSSAG
LIGVNGLSDYCASKFAALGFAESMFVETLAQKQRGIKTTIVCPFFIKTGMFEGCTTKCPN
LLPILDPEYAVRKIVDAILQEQLYLYMPKFLYFIMFLKSFLPIKTGILIADYLGLFHVMD
GFTGQKKKS
NT seq 930 nt   +upstreamnt  +downstreamnt
atgccttgcaacctggaatcagcgaaggacttgcttgttttcttagggaagtcactgttg
agtattttggaggctctactttctcatgtcatctcaaaaccacggaagaatgttgctggc
gaagtagtcctcatcacaggtgctgggagtggactcggaaggcttttagcattgcagttc
gcccgcctgggatcagtgctcgttctttgggatgtgaacaaggagacaaatgaggagacc
cgtcagatagctcaggaagcaggagccatcagagtgcatgcctacacctgtgactgcagc
cagagggaagaagtatacagagtggccgaccaggttaagaaagaagttggtgacgtctct
atcctcatcaacaatgctggcattgtaacaggcagaaagttcctcgattgcccagatgac
ctcatggaaaagtcacttgatgtcaatttcaaagcacatttatggatgtataaagccttt
ctacctgccatgattgctaacaaccatggccatttggtttgcatttcaagttcggctgga
ttgattggagtaaatgggctgtcagactattgtgcaagtaaattcgcagcccttggattt
gcagaatctatgtttgtcgaaacacttgcccaaaaacaaagggggatcaaaactactatt
gtgtgcccattctttataaaaactggaatgtttgaaggttgcactactaagtgtcctaat
ctgttaccaattctggatccagaatatgcagttaggaaaatagtagatgctatccttcag
gagcagctgtacttgtatatgcccaagtttttatacttcataatgtttttaaaaagcttc
ttgcccatcaagacaggaatacttatagctgactacctaggactctttcatgtgatggat
ggcttcactggtcaaaagaagaaatcttaa

DBGET integrated database retrieval system