KEGG   Rattus norvegicus (rat): 297891
Entry
297891            CDS       T01003                                 

Gene name
Tssk3, Stk22c, Tssk-3
Definition
(RefSeq) testis-specific serine kinase 3
  KO
K08811  testis-specific serine kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    297891 (Tssk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    297891 (Tssk3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     297891 (Tssk3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  TSSK family
   297891 (Tssk3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    297891 (Tssk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo Rdx
Other DBs
NCBI-GeneID: 297891
NCBI-ProteinID: NP_001007651
RGD: 1359231
Ensembl: ENSRNOG00000008693
UniProt: Q6V9Y3
Position
5q36
AA seq 268 aa
MEDFLLSNGYQLGKTIGEGTYSKVKEAFSKKHQRKVAIKIIDKMGGPEEFIQRFLPRELQ
IVRTLDHKNIIRVYEMLESADGKIYLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMVE
AIRYCHGCGVAHRDLKCENALLQGFNLKLTDFGFAKVLPKSRRELSQTFCGSTAYAAPEV
LQGIPHDSKKGDVWSMGVVLYVMLCASLPFDDTDIPKMLWQQQKGVSFPTHLGISTECQD
LLKRLLEPDMILRPSIEEVSWHPWLAST
NT seq 807 nt   +upstreamnt  +downstreamnt
atggaggactttctactctccaatgggtaccagctgggcaagaccattggggaagggacc
tactcaaaagtcaaagaagcattttccaaaaaacatcaaagaaaagtggcaattaaaatt
atagacaagatgggagggccagaagagtttatccagagattcctgcctcgggagctccag
attgtccgtaccctggaccacaaaaacatcatccgggtgtatgagatgctggaatcagcg
gatggaaaaatctacctggtgatggaactggctgagggaggggatgtctttgactgtgtg
ctgaacggagggccgctgcccgagagccgggccaaggccctcttccgccagatggtggag
gctattcgctactgccatggctgtggtgtggcccaccgggaccttaagtgtgagaacgcc
ttgttgcagggcttcaatctgaagctgaccgactttggctttgccaaggtgttacccaag
tcacgcagggagctgagccagaccttctgtggcagcacagcctatgccgcccctgaagtg
ctacagggcataccccatgatagcaagaaaggcgatgtctggagcatgggtgtggtcctg
tatgtaatgctctgcgcaagcctaccttttgatgatacagatatccccaagatgctgtgg
cagcagcagaagggggtgtccttccccacccatctgggcatctcaaccgaatgccaggac
ctgctcaagcggctcctggaaccagatatgatactccggccttcaatcgaagaagttagt
tggcacccatggctagcaagcacttga

DBGET integrated database retrieval system