KEGG   Rattus norvegicus (rat): 297893Help
Entry
297893            CDS       T01003                                 

Gene name
Hdac1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04213  Longevity regulating pathway - multiple species
rno04330  Notch signaling pathway
rno04919  Thyroid hormone signaling pathway
rno05016  Huntington's disease
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05165  Human papillomavirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05203  Viral carcinogenesis
rno05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    297893 (Hdac1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    297893 (Hdac1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    297893 (Hdac1)
  Aging
   04213 Longevity regulating pathway - multiple species
    297893 (Hdac1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    297893 (Hdac1)
   05202 Transcriptional misregulation in cancers
    297893 (Hdac1)
   05203 Viral carcinogenesis
    297893 (Hdac1)
   05220 Chronic myeloid leukemia
    297893 (Hdac1)
  Neurodegenerative diseases
   05016 Huntington's disease
    297893 (Hdac1)
  Substance dependence
   05031 Amphetamine addiction
    297893 (Hdac1)
   05034 Alcoholism
    297893 (Hdac1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    297893 (Hdac1)
   05165 Human papillomavirus infection
    297893 (Hdac1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     297893 (Hdac1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     297893 (Hdac1)
   HDAC complexes
    Sin3A-HDAC complex
     297893 (Hdac1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    297893 (Hdac1)
  Chromatin remodeling factors
   NuRD complex
    297893 (Hdac1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 297893
NCBI-ProteinID: NP_001020580
RGD: 1309799
Ensembl: ENSRNOG00000009568
UniProt: Q4QQW4
Position
5q36
AA seq 482 aa AA seqDB search
MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
MA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagactcagggcaccaagaggaaagtctgttactactacgacggggatgttgga
aactactattatggacaagggcacccaatgaagcctcaccgaatccgaatgactcataat
ttgctgctcaactatggtctctaccgaaaaatggaaatctatcgtcctcacaaagccaac
gctgaggagatgaccaagtaccacagcgacgactacatcaagttcttgcgttctattcgc
ccagacaatatgtctgaatacagcaagcagatgcagagattcaacgtgggtgaggactgt
ccggtatttgatggcttgtttgagttctgtcagttgtccacgggtggctctgtcgcgagt
gctgtgaaactcaataagcagcagacggacatcgctgtgaactgggctgggggcctgcac
catgcgaagaagtctgaagcatccggcttctgttacgtcaatgatattgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgacattcaccatggc
gatggcgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataaa
tacggagagtacttcccaggaactggggacctacgggatattggggctggcaaaggcaag
tactacgccgttaactacccactgcgagatggcattgatgatgagtcctatgaagccatc
tttaagccagtcatgtccaaagtaatggagatgttccagcctagtgcagtggtcctacag
tgcggctcagactccctgtctggggatcggctaggttgcttcaatctgaccatcaaagga
catgccaagtgtgtggagttcgtgaagagtttcaacttgccgatgctaatgttgggagga
ggtggctataccatccgtaatgtcgctcggtgctggacttacgagacagctgtggccctg
gacacagagatccctaatgagctaccatacaatgactactttgaatactttggaccagat
ttcaagcttcacatcagcccttccaatatgactaaccagaacactaatgaatacctggag
aagatcaagcagcggctctttgagaacttgagaatgctgccccatgcccctggggtccaa
atgcaggccatcccagaggatgccatcccagaagagagcggtgatgaggatgaggaagac
cctgacaaacgaatttccatctgctcctctgacaaacgcattgcctgtgaggaggaattc
tctgattctgatgaggagggagaaggaggtcgcaagaactcttctaacttcaaaaaagcc
aaaagagtcaaaacagaagatgaaaaagaaaaagatcccgaggagaaaaaagaagtcaca
gaagaggagaaaaccaaggaggagaagccagaagccaaaggggtcaaagaagaggtcaag
atggcctga

DBGET integrated database retrieval system