KEGG   Rattus norvegicus (rat): 297893
Entry
297893            CDS       T01003                                 

Gene name
Hdac1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04213  Longevity regulating pathway - multiple species
rno04330  Notch signaling pathway
rno04613  Neutrophil extracellular trap formation
rno04919  Thyroid hormone signaling pathway
rno05016  Huntington disease
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05165  Human papillomavirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05203  Viral carcinogenesis
rno05206  MicroRNAs in cancer
rno05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    297893 (Hdac1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    297893 (Hdac1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    297893 (Hdac1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    297893 (Hdac1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    297893 (Hdac1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    297893 (Hdac1)
   05202 Transcriptional misregulation in cancer
    297893 (Hdac1)
   05206 MicroRNAs in cancer
    297893 (Hdac1)
   05203 Viral carcinogenesis
    297893 (Hdac1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    297893 (Hdac1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    297893 (Hdac1)
   05165 Human papillomavirus infection
    297893 (Hdac1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    297893 (Hdac1)
  09165 Substance dependence
   05031 Amphetamine addiction
    297893 (Hdac1)
   05034 Alcoholism
    297893 (Hdac1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    297893 (Hdac1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     297893 (Hdac1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     297893 (Hdac1)
   HDAC complexes
    Sin3A-HDAC complex
     297893 (Hdac1)
    BRAF-HDAC complex
     297893 (Hdac1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    297893 (Hdac1)
  Chromatin remodeling factors
   NuRD complex
    297893 (Hdac1)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 297893
NCBI-ProteinID: NP_001020580
RGD: 1309799
Ensembl: ENSRNOG00000009568
UniProt: Q4QQW4
Position
5
AA seq 482 aa
MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
MA
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcgcagactcagggcaccaagaggaaagtctgttactactacgacggggatgttgga
aactactattatggacaagggcacccaatgaagcctcaccgaatccgaatgactcataat
ttgctgctcaactatggtctctaccgaaaaatggaaatctatcgtcctcacaaagccaac
gctgaggagatgaccaagtaccacagcgacgactacatcaagttcttgcgttctattcgc
ccagacaatatgtctgaatacagcaagcagatgcagagattcaacgtgggtgaggactgt
ccggtatttgatggcttgtttgagttctgtcagttgtccacgggtggctctgtcgcgagt
gctgtgaaactcaataagcagcagacggacatcgctgtgaactgggctgggggcctgcac
catgcgaagaagtctgaagcatccggcttctgttacgtcaatgatattgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgacattcaccatggc
gatggcgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataaa
tacggagagtacttcccaggaactggggacctacgggatattggggctggcaaaggcaag
tactacgccgttaactacccactgcgagatggcattgatgatgagtcctatgaagccatc
tttaagccagtcatgtccaaagtaatggagatgttccagcctagtgcagtggtcctacag
tgcggctcagactccctgtctggggatcggctaggttgcttcaatctgaccatcaaagga
catgccaagtgtgtggagttcgtgaagagtttcaacttgccgatgctaatgttgggagga
ggtggctataccatccgtaatgtcgctcggtgctggacttacgagacagctgtggccctg
gacacagagatccctaatgagctaccatacaatgactactttgaatactttggaccagat
ttcaagcttcacatcagcccttccaatatgactaaccagaacactaatgaatacctggag
aagatcaagcagcggctctttgagaacttgagaatgctgccccatgcccctggggtccaa
atgcaggccatcccagaggatgccatcccagaagagagcggtgatgaggatgaggaagac
cctgacaaacgaatttccatctgctcctctgacaaacgcattgcctgtgaggaggaattc
tctgattctgatgaggagggagaaggaggtcgcaagaactcttctaacttcaaaaaagcc
aaaagagtcaaaacagaagatgaaaaagaaaaagatcccgaggagaaaaaagaagtcaca
gaagaggagaaaaccaaggaggagaagccagaagccaaaggggtcaaagaagaggtcaag
atggcctga

KEGG   Rattus norvegicus (rat): 84576
Entry
84576             CDS       T01003                                 

Gene name
Hdac1l
Definition
(RefSeq) histone deacetylase 1-like
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04213  Longevity regulating pathway - multiple species
rno04330  Notch signaling pathway
rno04613  Neutrophil extracellular trap formation
rno04919  Thyroid hormone signaling pathway
rno05016  Huntington disease
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05165  Human papillomavirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05203  Viral carcinogenesis
rno05206  MicroRNAs in cancer
rno05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    84576 (Hdac1l)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    84576 (Hdac1l)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    84576 (Hdac1l)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    84576 (Hdac1l)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    84576 (Hdac1l)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    84576 (Hdac1l)
   05202 Transcriptional misregulation in cancer
    84576 (Hdac1l)
   05206 MicroRNAs in cancer
    84576 (Hdac1l)
   05203 Viral carcinogenesis
    84576 (Hdac1l)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    84576 (Hdac1l)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    84576 (Hdac1l)
   05165 Human papillomavirus infection
    84576 (Hdac1l)
  09164 Neurodegenerative disease
   05016 Huntington disease
    84576 (Hdac1l)
  09165 Substance dependence
   05031 Amphetamine addiction
    84576 (Hdac1l)
   05034 Alcoholism
    84576 (Hdac1l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    84576 (Hdac1l)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     84576 (Hdac1l)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     84576 (Hdac1l)
   HDAC complexes
    Sin3A-HDAC complex
     84576 (Hdac1l)
    BRAF-HDAC complex
     84576 (Hdac1l)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    84576 (Hdac1l)
  Chromatin remodeling factors
   NuRD complex
    84576 (Hdac1l)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 84576
NCBI-ProteinID: NP_445898
RGD: 619975
Ensembl: ENSRNOG00000013695
UniProt: D3ZVU7
Position
9
AA seq 484 aa
MAQTQGTERKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHYAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYE
AIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLML
GGDGYTIHNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEY
LEKIKQRLFENLRMLPHTPGVQMQAIPEDAIPEESGDEDEEDPDKPISICSSDKCIACEE
EFPDSDEEGEGGRENSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEE
VKMA
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggcgcagactcagggcaccgagaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaagggcacccaatgaagcctcaccgaatccgaatgactcataat
ttgctgctcaactatggtctctaccgaaaaatggaaatctatcgtcctcacaaagccaac
gctgaggagatgaccaagtaccacagcgacgactacatcaaattcttgcgttctattcgc
ccagacaatatgtctgaatacagcaagcagatgcagagattcaacgtgggtgaggactgt
ccagtatttgatggcttgtttgagttctgtcagttgtccacgggtggctctgtcgcgagt
gctgtgaaactcaataagcagcagacggacatcgctgtgaactgggctgggggcctgcac
tatgcaaagaagtctgaagcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaacttctaaagtaccaccagagggtgctgtatattgacattgatattcaccatggc
gatggcgatggcgtggaagaggccttctatactacagaccgggtcatgactgtgtccttt
cataaatacggagagtacttcccaggaactggggacctacgggatattggggctggcaaa
ggcaagtactacgccgttaactacccactgcgagacggcattgatgatgagtcctatgaa
gccatcttcaagccagtcatgtccaaagtaatggagatgtttcagcctagtgcagtggtc
ctacagtgcggctcagactccctgtctggggatcggctaggttgcttcaatctgaccatc
aaaggacatgccaagtgtgtggagttcgtgaagagtttcaacttgccaatgctaatgttg
ggaggagatggctataccatccataatgtcgctcggtgctggacttacgagacagctgtg
gccctggacacagagatccctaatgagctaccgtacaatgactactttgaatactttgga
ccagatttcaagcttcacatcagcccttccaatatgactaaccagaacactaatgaatac
ctggagaagatcaagcagcggctctttgagaacttgagaatgctgccccatacccctggg
gtccaaatgcaggccatccctgaggatgccatcccagaagagagcggtgatgaggatgag
gaagaccctgacaaaccaatttccatctgctcctctgacaaatgcattgcctgtgaggag
gaattccctgattctgatgaggagggagaaggaggtcgagagaactcttctaacttcaaa
aaagccaaaagagtcaaaacagaagatgaaaaagaaaaagatcccgaggagaaaaaagaa
gtcacagaagaggagaaaaccaaggaggagaagccagaagccaaaggggtcaaagaagag
gtcaagatggcctga

KEGG   Rattus norvegicus (rat): 84577
Entry
84577             CDS       T01003                                 

Gene name
Hdac2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04213  Longevity regulating pathway - multiple species
rno04330  Notch signaling pathway
rno04613  Neutrophil extracellular trap formation
rno04919  Thyroid hormone signaling pathway
rno05016  Huntington disease
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05165  Human papillomavirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05203  Viral carcinogenesis
rno05206  MicroRNAs in cancer
rno05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    84577 (Hdac2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    84577 (Hdac2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    84577 (Hdac2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    84577 (Hdac2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    84577 (Hdac2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    84577 (Hdac2)
   05202 Transcriptional misregulation in cancer
    84577 (Hdac2)
   05206 MicroRNAs in cancer
    84577 (Hdac2)
   05203 Viral carcinogenesis
    84577 (Hdac2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    84577 (Hdac2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    84577 (Hdac2)
   05165 Human papillomavirus infection
    84577 (Hdac2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    84577 (Hdac2)
  09165 Substance dependence
   05031 Amphetamine addiction
    84577 (Hdac2)
   05034 Alcoholism
    84577 (Hdac2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    84577 (Hdac2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     84577 (Hdac2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     84577 (Hdac2)
   HDAC complexes
    Sin3A-HDAC complex
     84577 (Hdac2)
    BRAF-HDAC complex
     84577 (Hdac2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    84577 (Hdac2)
  Chromatin remodeling factors
   NuRD complex
    84577 (Hdac2)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 84577
NCBI-ProteinID: NP_445899
RGD: 619976
Ensembl: ENSRNOG00000000604
UniProt: F7ENH8 B1WBY8
Position
20
AA seq 488 aa
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAVLELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKEAEDKRTDVKEEDKSKDNSGEKTDTKGA
KSEQLNNP
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggcgtacagtcaaggaggcggcaagaagaaagtgtgctactattatgacggtgatatc
gggaattattattacggccagggtcatcccatgaagccccataggatccggatgactcat
aacttgcttctaaattatggtttataccgaaaaatggaaatatataggcctcataaggcc
actgctgaagaaatgacaaaataccacagtgatgagtatatcaagtttctacgatcaata
aggccagataacatgtcagagtatagtaagcagatgcagagatttaatgtcggagaagac
tgtccagtgttcgatggactctttgagttttgtcagctctccaccggtggctcagttgct
ggggccgtgaagctgaaccgtcaacagactgacatggctgtcaactgggcgggaggactg
caccacgccaagaagtcagaggcctcaggattctgctacgttaatgacattgtgcttgct
gtcctcgagctactgaaatatcatcagagagtcttatatattgacatagacatccaccat
ggtgatggtgttgaggaagctttttatacaacagatcgcgtgatgaccgtctcattccat
aaatacggagaatactttcctggaacaggagacttgagggatattggtgctggaaaagga
aagtactacgctgtcaactttcccatgagggacggtatagatgacgagtcatatggacag
atatttaagcctataatctcaaaagtgatggagatgtaccagccgagcgcggtggtgctg
cagtgtggcgctgactccctctctggtgacaggctgggctgcttcaacctaactgtcaaa
ggtcacgctaaatgtgtagaagtagtgaaaacttttaacttgccgttgctgatgcttggc
ggaggtggctacacaatccggaatgttgctcgatgttggacgtatgagactgcagttgcc
cttgattgtgaaattcccaatgagttgccatataatgattacttcgagtattttggacca
gacttcaaactgcatattagtccctcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttatttgaaaatctgcgaatgttaccacatgcgcctggtgtt
caaatgcaagctattccagaagatgctgttcatgaagacagtggtgatgaggatggagaa
gaccctgacaagagaatttctattcgagcatcagacaagcggatagcttgtgatgaagag
ttctcagattctgaggatgaaggtgaaggaggtcgtaggaatgtcgctgatcataagaag
ggagccaaaaaagccaggattgaggaagacaagaaggaggcggaggacaagaggacagat
gttaaggaagaagacaaatccaaggacaatagtggtgagaaaacagacaccaaaggagcc
aaatcagaacaactcaacaacccttga

DBGET integrated database retrieval system