KEGG   Rattus norvegicus (rat): 297932Help
Entry
297932            CDS       T01003                                 

Gene name
Atp6v0d2
Definition
(RefSeq) ATPase H+ transporting V0 subunit D2
  KO
K02146  V-type H+-transporting ATPase subunit d
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04142  Lysosome
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05152  Tuberculosis
rno05165  Human papillomavirus infection
rno05203  Viral carcinogenesis
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    297932 (Atp6v0d2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    297932 (Atp6v0d2)
   04142 Lysosome
    297932 (Atp6v0d2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    297932 (Atp6v0d2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    297932 (Atp6v0d2)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    297932 (Atp6v0d2)
  09163 Immune diseases
   05323 Rheumatoid arthritis
    297932 (Atp6v0d2)
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    297932 (Atp6v0d2)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    297932 (Atp6v0d2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: vATP-synt_AC39
Motif
Other DBs
NCBI-GeneID: 297932
NCBI-ProteinID: NP_001011972
RGD: 1306900
Ensembl: ENSRNOG00000006926
UniProt: Q5FVL0
Position
5q13
AA seq 350 aa AA seqDB search
MLETAELYFNVDHGYLEGLVRGCKASLLTQQDYVNLVQCETLEDLKIHLQTTDYGNFLAH
ETNPLTVSKIDTEMRKKLCREFDYFRNHSLEPLSTFFTYMTCSYMIDNIILLMNGALQKK
SVKEVLAKCHPLGRFTEMEAVNIAESASELFKAVLVETPLAPFFQDCMSENTLDELNIEL
LRNKLYKSYLEAFYKFCKDHGDVTAEVMCPILEFEADRRALIITLNSFGTELSKEDRETL
FPTCGKLYPEGLRLLAQAEDFEHMKRVADNYGVYKPLFDAVGGSGGKTLEDVFYEREVQM
NVLAFNRQFHYGVFYAYVKLKEQEMRNIVWIAECISQRHRTKINSYIPIL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagacggcagagctgtacttcaatgtggaccatggctacctggagggcctggtg
cgagggtgcaaagccagcctcctaactcagcaggactatgtcaacttagtgcagtgtgag
accttggaagatttgaaaattcatctccagaccactgactatggcaacttcctggctcat
gaaacaaaccctctcactgtttccaaaattgacacggagatgaggaagaagctatgcaga
gagtttgactatttccgaaatcattccttggagcccctcagcacatttttcacctacatg
acgtgcagctatatgatagacaacataattctactgatgaatggggcattgcaaaagaaa
tccgtgaaagaagttctagccaagtgtcacccattgggccgcttcactgaaatggaagcc
gtcaacattgcagagagcgcctcagagctcttcaaggctgtgctggttgaaacaccatta
gctccattcttccaagattgtatgtctgaaaatactcttgatgaactgaatattgaatta
ctgcgcaataaactatacaagtcttacctcgaggcattctacaaattctgcaaggatcac
ggtgatgtcacagcagaagttatgtgtcccattcttgagtttgaggccgacagacgcgct
ttaatcatcactctgaactcatttggcactgaactgagcaaagaagacagggagaccctc
ttccccacctgcggcaagctctatccggagggactgcggctgttagcccaagccgaagac
ttcgagcacatgaagagagtggcagataattacggagtttacaagcctttgtttgacgcc
gtaggtggcagtgggggaaagacactggaagatgttttctatgagcgagaggtacagatg
aatgtgctggcgttcaacaggcaattccactatggtgtgttttatgcctatgtaaagttg
aaggagcaggagatgagaaatatcgtgtggatagcagaatgcatctcacagcgacatcga
actaaaatcaacagctacattccaattttataa

DBGET integrated database retrieval system