KEGG   Rattus norvegicus (rat): 297995Help
Entry
297995            CDS       T01003                                 

Gene name
Chmp5, RGD1305968
Definition
(RefSeq) charged multivesicular body protein 5
  KO
K12198  charged multivesicular body protein 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    297995 (Chmp5)
  09143 Cell growth and death
   04217 Necroptosis
    297995 (Chmp5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    297995 (Chmp5)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    297995 (Chmp5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 NPV_P10 Spc7 Prefoldin_2 Alpha-E DUF948 Hydantoinase_B DUF848
Motif
Other DBs
NCBI-GeneID: 297995
NCBI-ProteinID: NP_001020581
RGD: 1305968
Ensembl: ENSRNOG00000008672
UniProt: Q4QQV8
Position
5q22
AA seq 219 aa AA seqDB search
MNRFFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNM
VKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAY
KEVKIDQIEDLQDQLEDMMEDANEIQEALGRSYGTPELDEDDLEAELDALGDELLADEDS
SYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQIPAS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgattcttcggaaaagcgaaacccaaggctccgccacctagcctgactgactgc
attgggacggtggatagcagggcagaatccattgacaaaaagatttcccggttggatgct
gaactggtgaaatataaggaccaaatcaagaagatgagagagggtcctgctaagaacatg
gtcaaacagaaagccctgagggttttaaagcaaaaacggatgtatgagcagcagcgagac
aaccttgcccaacagtcctttaacatggagcaagctaattacaccatccagtcactgaag
gataccaaaaccacggttgatgcaatgaaattgggagtaaaggaaatgaagaaggcttac
aaggaagtaaaaattgaccagattgaggatttacaagaccagttggaagacatgatggaa
gatgcaaatgagatccaggaggccctgggccgcagctacggcaccccagaactggatgag
gacgacctggaagcagagttggatgcgctgggcgatgagcttctggctgatgaggacagc
tcttacttggacgaagcagcttctgcaccggcaattccagagggcgttcccactgacaca
aaaaacaaggatggagtgctggtggatgaatttggactgccacagattccagcttcgtag

DBGET integrated database retrieval system