KEGG   Rattus norvegicus (rat): 298003
Entry
298003            CDS       T01003                                 

Gene name
Galt
Definition
(RefSeq) galactose-1-phosphate uridylyltransferase
  KO
K00965  UDPglucose--hexose-1-phosphate uridylyltransferase [EC:2.7.7.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00052  Galactose metabolism
rno00520  Amino sugar and nucleotide sugar metabolism
rno01100  Metabolic pathways
rno04917  Prolactin signaling pathway
Module
rno_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
rno_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    298003 (Galt)
   00520 Amino sugar and nucleotide sugar metabolism
    298003 (Galt)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    298003 (Galt)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.12  UDP-glucose---hexose-1-phosphate uridylyltransferase
     298003 (Galt)
SSDB
Motif
Pfam: GalP_UDP_tr_C GalP_UDP_transf HIT
Other DBs
NCBI-GeneID: 298003
NCBI-ProteinID: NP_001013107
RGD: 1306483
Ensembl: ENSRNOG00000014766
UniProt: P43424
Position
5q22
AA seq 379 aa
MSQSGADPEQRQQASEADAMAATFRASEHQHIRYNPLQDEWVLVSAHRMKRPWQGQVEPQ
LLKTVPRHDPLNPLCPGATRANGEVNPPYDGTFLFDNDFPALQPDAPDPGPSDHPLFRVE
AARGVCKVMCFHPWSDVTLPLMSVPEIRAVIDAWASVTEELGAQYPWVQIFENKGAMMGC
SNPHPHCQVWASNFLPDIAQREERSQQTYHNQHGKPLLLEYGHQELLRKERLVLTSEYWI
VLVPFWAVWPFQTLLLPRRHVQRLPELTPAERDDLASTMKKLLTKYDNLFETSFPYSMGW
HGAPMGLKTGATCDHWQLHAHYYPPLLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRV
LPEVHYCLTQKDKETAATA
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgtcgcaaagcggagccgatcctgagcagcgccagcaggcttcagaggcggacgccatg
gcagcgaccttccgggcgagcgaacaccagcatattcgctacaacccgctccaggatgag
tgggtgttagtgtcagcccatcgcatgaagcggccctggcaaggacaagtggagccccag
cttctgaagacggtcccccgccatgacccactcaaccctctgtgtcccggggccacacga
gctaatggggaggtgaatcccccctatgatggcaccttcttatttgacaatgacttcccg
gctctgcagcccgatgctccggatccaggacccagtgaccaccctctcttccgagtggag
gccgccagaggagtttgtaaggtcatgtgcttccacccctggtcggatgtgacgctgcca
ctcatgtctgtccctgagatccgagctgtcatcgatgcatgggcctcagtcacagaggaa
ctgggcgcccagtacccttgggtgcagatctttgaaaacaaaggagccatgatgggttgc
tctaacccccatccccactgccaggtttgggctagcaatttcctgccagatattgcccag
cgtgaagagcgatcccagcagacttatcacaaccagcatggaaagcctttattattggaa
tatggccaccaagagctcctcaggaaggaacgtctggtcctaaccagtgagtactggata
gttctggtccccttctgggcagtgtggcctttccagacattactgctgccccgacggcac
gtgcagcggctacctgagctgacccctgctgagcgtgatgatctagcctccaccatgaag
aagctcttgaccaagtatgacaacctgtttgagacgtcctttccttactccatgggctgg
cacggggctcccatgggattaaagactggagccacctgtgaccactggcagctccatgct
cactattaccccccactcctgcgatcggctactgttcggaaattcatggttggctatgaa
atgcttgcccaggcccagcgtgacctcactcccgaacaggctgcagaaagattaagggtg
ctccctgaggtacactattgcctgacgcagaaagacaaggaaacagcagccaccgcttga

DBGET integrated database retrieval system