KEGG   Rattus norvegicus (rat): 298006
Entry
298006            CDS       T01003                                 

Gene name
Ccl21, Ccl21b
Definition
(RefSeq) C-C motif chemokine ligand 21
  KO
K16062  C-C motif chemokine 21
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    298006 (Ccl21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    298006 (Ccl21)
   04061 Viral protein interaction with cytokine and cytokine receptor
    298006 (Ccl21)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    298006 (Ccl21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    298006 (Ccl21)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   298006 (Ccl21)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 298006
NCBI-ProteinID: NP_001008513
RGD: 1311996
Ensembl: ENSRNOG00000034290
UniProt: Q5RJN3
Position
5q22
AA seq 133 aa
MAQMLALSLLSLVLVLCVPWTQGSDGGGQDCCLRYSQKKIPYNIVRGYRKQEPSLGCPIP
AILFAPRKQSQPELCANPEEAWVQKLMRRLDQPPAPGKQNCRKNRGTSKSGKKGRGSKGC
KGTEQTDSKRVSQ
NT seq 402 nt   +upstreamnt  +downstreamnt
atggctcagatgctggctctgagcctccttagcttggtcctggttctctgcgtcccgtgg
acccaaggcagtgacggagggggtcaggactgctgtcttaggtacagccagaagaagatt
ccctacaacattgtccgaggctacaggaagcaagaaccgagcctaggttgccccatccca
gcaatcctgttcgcaccccggaagcaatctcagcctgagctatgcgcaaaccctgaggaa
gcctgggtgcagaagctgatgcgacgtctggaccagcctccagccccagggaaacaaaac
tgcaggaagaatcgaggaacctctaagtctgggaagaaaggaaggggctccaaaggctgc
aaggggactgaacagacagactccaagagggtatcccagtga

DBGET integrated database retrieval system