KEGG   Rattus norvegicus (rat): 298033Help
Entry
298033            CDS       T01003                                 

Gene name
Snx30, RGD1311367
Definition
(RefSeq) sorting nexin family member 30
  KO
K17921  sorting nexin-7/30
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    298033 (Snx30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PX Vps5 BAR
Motif
Other DBs
NCBI-GeneID: 298033
NCBI-ProteinID: NP_001100121
RGD: 1311367
Ensembl: ENSRNOG00000017132
UniProt: D4A060
Position
5q24
AA seq 437 aa AA seqDB search
MAGGPPKALPSTGPQSLRDMPHPLAGSSSEEAVGGDSTPSPDLLMARSFGDKDLILPNGG
TPAGTSSPASSSSLLNRLQLDDDIDGETRDLFVTVDDPKKHVCTMETYITYRITTKSTRV
EFDLPEYSVRRRYQDFDWLRNKLEESQPTHLIPPLPEKFVVKGVVDRFSEEFVETRRKAL
DKFLKRITDHPVLSFNEHFNVFLTAKDLNAYKKQGIALLTRVGESVKHVTGGYKLRSRPL
EFAAIGDYLDTFALKLGTIDRIAQRIIKEEIEYLVELREYGPVYSTWSALEGELAEPLEG
VSACIGNCSTALEELTDDITEEFLPVLREYILYSDSMKGVLKKRDQVHAEYEAKLEAVAL
RKEDRPKVPADVEKCQDRMECFNADLKADMERWQGNKRNDFRQLLVGLADKNIQYYEKCL
MAWESIIPLLQEKQEAK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgggccccccaaggccctgccgtccacggggccccagtccttgcgcgacatg
ccccacccgctagcgggctccagcagcgaggaggccgtgggaggcgacagcacgcccagc
ccggacctactgatggcccgcagcttcggtgacaaggatctcatcttgcccaatggtggt
actccagcaggcacttcaagcccagcttcttcatcttcgcttttgaacagacttcagctg
gatgatgacattgatggtgaaaccagagatctctttgtcacagttgatgatcccaagaag
catgtctgcacaatggagacctacatcacgtacaggatcaccaccaaaagcacacgggtg
gagtttgacttgccagagtattccgttcgtcgacgataccaggatttcgactggttgagg
aacaaactggaagagtcgcagcccactcatctcattcccccacttcctgagaagtttgtg
gtgaagggtgtcgtggatcgtttttcagaagagtttgtggagaccagaagaaaagcgttg
gacaaattcctaaaaaggattacagatcacccagtgctctctttcaatgaacacttcaat
gtgttcctcactgctaaggacctgaatgcctacaagaagcaggggatagcactgctgacc
agagtgggggagtcggtcaagcatgtcactggaggctacaagctgcggagtcggcctctg
gagtttgcagccatcggtgactacttagacacttttgcactcaaactgggaaccattgat
cggatagcccagcggatcatcaaagaagaaatagagtacctcgtggagctgagggagtat
gggcctgtgtattccacgtggagcgccttggaaggtgagctggcggagcccctggagggt
gtgtcagcctgcattgggaactgctccacagccttggaagagctgacggatgacataaca
gaagagtttctgcctgtgctcagggaatacattctatactctgactccatgaagggtgtg
ttgaagaagagggaccaagttcatgcagagtatgaagccaaactggaagctgtggctctg
aggaaagaagatcgccccaaggtgccagcagatgtggagaagtgccaggacaggatggag
tgcttcaacgcagacctgaaggctgatatggagaggtggcagggcaacaagcgaaatgac
ttccggcagctgctcgtgggcttggctgacaagaatatccagtattatgagaagtgcctc
atggcgtgggagtcgattattccactactgcaagagaaacaagaggccaagtag

DBGET integrated database retrieval system