KEGG   Rattus norvegicus (rat): 298068
Entry
298068            CDS       T01003                                 

Gene name
Sec61b
Definition
(RefSeq) protein transport protein Sec61 subunit beta
  KO
K09481  protein transport protein SEC61 subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
rno04141  Protein processing in endoplasmic reticulum
rno04145  Phagosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    298068 (Sec61b)
   04141 Protein processing in endoplasmic reticulum
    298068 (Sec61b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    298068 (Sec61b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    298068 (Sec61b)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   298068 (Sec61b)
SSDB
Motif
Pfam: Sec61_beta
Other DBs
NCBI-GeneID: 298068
NCBI-ProteinID: NP_001100124
RGD: 1304997
Ensembl: ENSRNOG00000006345
UniProt: B2RZD1
Position
5
AA seq 96 aa
MPGPTPSATNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYT
EDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
NT seq 291 nt   +upstreamnt  +downstreamnt
atgccgggtccaacgcctagtgccaccaacgtgggctcctctgggcgttctcctagcaaa
gcagtggccgcacgggcggcgggatccactgtccggcagagaaaaaatgccagctgcgga
acccggagtgcaggccgcaccacctctgcagggactggggggatgtggcgattctacaca
gaagattccccagggctcaaagttggccctgtcccagtactggtgatgagtcttctgttc
atcgcttctgtgtttatgctgcacatttggggcaagtacacgcgttcatag

DBGET integrated database retrieval system