KEGG   Rattus norvegicus (rat): 298068
Entry
298068            CDS       T01003                                 

Gene name
Sec61b
Definition
(RefSeq) protein transport protein Sec61 subunit beta
  KO
K09481  protein transport protein SEC61 subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
rno04141  Protein processing in endoplasmic reticulum
rno04145  Phagosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    298068 (Sec61b)
   04141 Protein processing in endoplasmic reticulum
    298068 (Sec61b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    298068 (Sec61b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    298068 (Sec61b)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   298068 (Sec61b)
SSDB
Motif
Pfam: Sec61_beta
Other DBs
NCBI-GeneID: 298068
NCBI-ProteinID: NP_001100124
RGD: 1304997
Ensembl: ENSRNOG00000006345
UniProt: B2RZD1
Position
5
AA seq 96 aa
MPGPTPSATNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYT
EDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
NT seq 291 nt   +upstreamnt  +downstreamnt
atgccgggtccaacgcctagtgccaccaacgtgggctcctctgggcgttctcctagcaaa
gcagtggccgcacgggcggcgggatccactgtccggcagagaaaaaatgccagctgcgga
acccggagtgcaggccgcaccacctctgcagggactggggggatgtggcgattctacaca
gaagattccccagggctcaaagttggccctgtcccagtactggtgatgagtcttctgttc
atcgcttctgtgtttatgctgcacatttggggcaagtacacgcgttcatag

KEGG   Rattus norvegicus (rat): 361273
Entry
361273            CDS       T01003                                 

Gene name
Sec61a2
Definition
(RefSeq) protein transport protein Sec61 subunit alpha
  KO
K10956  protein transport protein SEC61 subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
rno04141  Protein processing in endoplasmic reticulum
rno04145  Phagosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    361273 (Sec61a2)
   04141 Protein processing in endoplasmic reticulum
    361273 (Sec61a2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    361273 (Sec61a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    361273 (Sec61a2)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   361273 (Sec61a2)
SSDB
Motif
Pfam: SecY Plug_translocon
Other DBs
NCBI-GeneID: 361273
NCBI-ProteinID: NP_001163814
RGD: 1305948
Ensembl: ENSRNOG00000023278
Vega: OTTRNOG00000001991
UniProt: D3ZEH3
Position
17
AA seq 476 aa
MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSAD
PFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFG
MIITIGQAIVYVMTGMYGDPAEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGIS
LFIATNICETIVWKAFSPTTINTGRGTEFEGAVIALFHLLATRTDKVRALREAFYRQNLP
NLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSN
LYVISQMLSVRFSGNFLVNLLGQWADVSGGGPARSYPVGGLCYYLSPPESMGAIFEDPVH
VVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTA
AAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQAEVGGMGALFF
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgggcatcaagtttttagaagttattaaacctttctgtgcagttctaccagaaattcag
aagcctgaaaggaaaattcagtttagagagaaggtactgtggactgctataacactcttc
attttcttagtatgctgtcagattccactgtttgggatcatgtcgtcggactctgcggat
cccttctactggatgagagttattcttgcatccaacagaggaacattgatggaattgggt
atttccccaattgtaacatctggtttgattatgcagttgttagctggagccaaaatcatt
gaagtcggagatacacccaaagatagagctctgttcaatggagcccagaaactatttggt
atgatcattaccattgggcaagccattgtgtatgtcatgacggggatgtacggggaccct
gcagaaatgggtgctgggatctgcctccttatcattattcagttgtttgttgctggtttg
attgtgctgctgttagatgagctgctacagaagggttacggcttggggtctggtatttcc
ctctttattgccaccaacatctgtgaaaccattgtctggaaggcctttagtcccactacc
attaacactggcagaggtacggagtttgaaggtgcagtcatagctctgtttcatttgttg
gctacccggacagacaaggtccgagccctgagggaggccttctatcggcagaacctcccc
aacctcatgaacctcatcgccaccgtcttcgtgtttgcggtcgtcatctattttcagggg
tttcgtgttgacttgcccattaagtcggcccggtatcgcggacagtacagtagctatccc
atcaagctcttctacacatcgaatattcccataatcctccagtccgccctagtttcaaac
ttgtacgtcatttcccagatgctgtctgttcgatttagtggcaacttcttagtaaactta
ctaggacagtgggccgatgtcagcgggggaggacctgctcgctcctaccctgttggtggc
ctgtgttactatctctctcctcctgagtccatgggagccatatttgaggatcctgttcat
gtagtcgtgtatattatcttcatgttggggtcgtgtgcattcttttctaagacgtggata
gaagtttctggttcctcagccaaagatgtggccaagcagcttaaagagcagcagatggtg
atgaggggccacagagacacctccatggttcatgagctgaacaggtacatccccacagca
gctgcctttgggggtctatgcatcggtgccctgtcggtactagcagacttcctgggcgcc
attggctcgggcactggaattctgcttgcagtcactattatttatcagtattttgaaata
tttgttaaggaacaggctgaagttggtggaatgggtgctttgtttttctaa

KEGG   Rattus norvegicus (rat): 689134
Entry
689134            CDS       T01003                                 

Gene name
Sec61g
Definition
(RefSeq) protein transport protein Sec61 subunit gamma
  KO
K07342  protein transport protein SEC61 subunit gamma and related proteins
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
rno04141  Protein processing in endoplasmic reticulum
rno04145  Phagosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    689134 (Sec61g)
   04141 Protein processing in endoplasmic reticulum
    689134 (Sec61g)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    689134 (Sec61g)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    689134 (Sec61g)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   689134 (Sec61g)
SSDB
Motif
Pfam: SecE Pho88
Other DBs
NCBI-GeneID: 689134
NCBI-ProteinID: NP_001128492
RGD: 1596170
Ensembl: ENSRNOG00000005203
UniProt: B5DEL7
Position
14
AA seq 68 aa
MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIP
INNIIVGG
NT seq 207 nt   +upstreamnt  +downstreamnt
atggatcaggtaatgcagtttgtcgagccaagtcggcagtttgtaaaggactcgattcgg
ctggttaaaagatgcaccaaacctgatagaaaagaattccagaagatcgccatggccaca
gcgattggattcgctatcatggggttcatcggcttctttgtgaaactgatccacatccct
attaataacattattgtgggtggctga

KEGG   Rattus norvegicus (rat): 80843
Entry
80843             CDS       T01003                                 

Gene name
Sec61a1
Definition
(RefSeq) protein transport protein Sec61 subunit alpha isoform 1
  KO
K10956  protein transport protein SEC61 subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
rno04141  Protein processing in endoplasmic reticulum
rno04145  Phagosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    80843 (Sec61a1)
   04141 Protein processing in endoplasmic reticulum
    80843 (Sec61a1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    80843 (Sec61a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    80843 (Sec61a1)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   80843 (Sec61a1)
SSDB
Motif
Pfam: SecY Plug_translocon DUF2975
Other DBs
NCBI-GeneID: 80843
NCBI-ProteinID: NP_954865
RGD: 68321
Ensembl: ENSRNOG00000013743
UniProt: P61621
Position
4
AA seq 476 aa
MAIKFLEVIKPFCVILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSAD
PFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFG
MIITIGQSIVYVMTGMYGDPSEMGAGICLLITIQLFVAGLIVLLLDELLQKGYGLGSGIS
LFIATNICETIVWKAFSPTTVNTGRGMEFEGAIIALFHLLATRTDKVRALREAFYRQNLP
NLMNLIATIFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSN
LYVISQMLSARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLEDPVH
AVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTA
AAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEVGSMGALLF
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggcgatcaaatttctggaagtcatcaagccattctgtgtcatcttgccggaaattcag
aagccagagagaaagattcagtttaaggagaaggtgttgtggacggccatcaccctcttc
atcttcttagtatgctgccagattcccctgtttggcatcatgtcttcagactcagctgac
cccttctactggatgcgagtgattctggcctctaacagaggtaccttgatggagctgggt
atctctcctattgtcacgtccggccttatcatgcagctcttagctggtgccaagataatt
gaagttggggacaccccgaaagaccgagctctcttcaatggagcccaaaagttgtttgga
atgatcatcactatcggtcagtccattgtgtacgtgatgacgggcatgtacggggaccct
tcagagatgggtgctggaatctgcctgctgatcaccattcagctctttgttgctggctta
attgtcctacttttggatgaactcctgcagaaaggatatggcttgggctctggcatctct
ctcttcattgcgactaatatctgtgagaccattgtatggaaggcattcagccccaccact
gtcaacactggccgagggatggaatttgaaggcgccatcattgcgctgttccacctgctg
gccacccgcacagacaaggtccgagcccttcgagaggcattctaccgccagaacctccct
aacctcatgaacctgattgccaccatcttcgtctttgctgttgtcatctatttccagggc
ttccgagtggaccttccaatcaagtcggcgcgttaccgaggccagtacaatacctacccc
atcaagctcttctacacctccaacattcccatcatcttgcagtctgctctggtgtccaac
ctgtatgtcatctcccagatgctgtcagcacgtttcagtggcaacctgctggttagcctg
ctgggcacctggtcggatacgtcatctgggggcccagcccgtgcttacccagttggtggc
ctgtgttactacctgtctcctccggaatcattcggctcagtgctggaggaccctgtccat
gcggtcgtgtacattgtattcatgctgggttcctgtgcattcttttccaaaacatggatc
gaagtttcgggttcttctgccaaagatgttgccaagcagctgaaggagcagcagatggtg
atgagaggccacagggagacctccatggtgcatgagctcaaccggtacatccccacagct
gcagccttcggtgggctgtgcattggggccctctctgtcctggctgatttcctgggtgct
atcgggtctggcaccgggatcctgctggcggtcaccatcatctaccagtactttgagatc
ttcgtcaaagagcagagcgaggtgggcagcatgggagcccttctcttctga

DBGET integrated database retrieval system