KEGG   Rattus norvegicus (rat): 298072Help
Entry
298072            CDS       T01003                                 

Gene name
Trmo, Nap1, RGD1305420
Definition
(RefSeq) tRNA methyltransferase O
  KO
K22900  tRNA (adenine37-N6)-methyltransferase [EC:2.1.1.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rno03016]
    298072 (Trmo)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     298072 (Trmo)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    298072 (Trmo)
 Prokaryotic type
    298072 (Trmo)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TrmO TrmO_C
Motif
Other DBs
NCBI-GeneID: 298072
NCBI-ProteinID: NP_001020823
RGD: 1305420
Ensembl: ENSRNOG00000009492
UniProt: Q4V7E0
Position
5q22
AA seq 431 aa AA seqDB search
MRGLEKQGPSATAAPCGCAQPALETGNLLTEPIGYLESCFSAKIGTPRQPSICSQSRACL
KIRKSIFNNPEHSLMGLEQFSHVWILFVFHKNGHLNYKAKVQPPRLNGAKTGVFSTRSPH
RPNAIGLTLAKLEKVEGGAVYLSGIDMIHGTPVLDIKPYIADYDSPQNLEPQTKHHKLRA
AGPSDATANSCDQQLLSGCEKAQPCHSTKEKPKCREHRTSDENSQKFRDTSEIQHTLPED
RERAVDLALESSREETMDEPEDQLGPQELKSFLEEGTDRPRKVEGALVLRGSSAETRWDA
SCHARTADRVPCSVVPSWVKEAPVATLQVRFTPHAEMDLRKLSSGGASQTSFKYFHSAEE
AKCAIEAMLSADPRSVYRRKLCEDRLFFFTVDIAHVTCWFGDGFAEVLRIKLASEPVEVA
DPEESLVALGS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcttggagaagcagggtccgagtgctacagcggccccatgtgggtgcgctcag
ccggccctggagacagggaatcttttaactgagccaatagggtacttggaatcatgtttc
tcagccaagattggtactccaaggcagccatccatttgtagccaatccagagcctgtttg
aagatcagaaagagcatctttaataatcctgaacattccttgatgggcctagaacagttt
tctcatgtttggatcttgtttgtctttcataaaaacggccatttgaattacaaggcaaaa
gtgcaaccccctaggctgaacggggcaaagaccggagtgttctccacacggagcccccat
cgcccgaatgcaataggactgacactggccaagctggagaaggtggaaggtggagctgta
tacctgtctggaattgacatgatacacggcacacctgtgctagacataaagccctacatt
gccgactacgactcaccacagaacttggagccacagactaaacaccacaagctgagggct
gcgggcccatctgacgccacagctaacagttgtgaccagcagctgctctcagggtgtgag
aaagcacagccttgccacagcaccaaggagaaaccgaaatgccgtgaacacaggacctcg
gatgaaaactcccagaagttcagagacacctcagaaatccagcacactttgccagaggac
agagagagagcagtggatttagccctggaatcaagcagagaggaaaccatggatgagcct
gaagatcagcttggcccacaggagctgaagagctttctggaagaaggcacagatagacca
aggaaagtggaaggtgccttggtcctgcgggggagcagtgcagaaacacggtgggatgct
tcctgccatgccaggacagctgacagagtgccctgcagtgttgtccccagctgggtgaag
gaggctcctgtagccactttacaagtccggtttactcctcatgcagagatggatctgagg
aagctcagttcaggaggtgctagtcagacgtcgtttaaatacttccattccgcagaggaa
gccaagtgtgccattgaggctatgctgtcagcagaccctcggtctgtgtaccggcggaag
ctctgtgaggaccgccttttcttctttactgtggacatagcacatgtcacgtgctggttt
ggtgatggctttgcagaggttctgaggattaaactggcttctgagcctgttgaggtggct
gaccctgaggagtctttggtggccttggggtcttga

DBGET integrated database retrieval system