KEGG   Rattus norvegicus (rat): 298075
Entry
298075            CDS       T01003                                 

Gene name
Ncbp1
Definition
(RefSeq) nuclear cap-binding protein subunit 1
  KO
K12882  nuclear cap-binding protein subunit 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno03040  Spliceosome
rno05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    298075 (Ncbp1)
  09122 Translation
   03013 RNA transport
    298075 (Ncbp1)
   03015 mRNA surveillance pathway
    298075 (Ncbp1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    298075 (Ncbp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    298075 (Ncbp1)
   03041 Spliceosome [BR:rno03041]
    298075 (Ncbp1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Cap binding complex
     298075 (Ncbp1)
Spliceosome [BR:rno03041]
 Common components
  Common spliceosomal components
   Cap binding complex
    298075 (Ncbp1)
SSDB
Motif
Pfam: MIF4G_like_2 MIF4G_like MIF4G DUF1690 Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 298075
NCBI-ProteinID: NP_001014785
RGD: 1308973
Ensembl: ENSRNOG00000023605
UniProt: Q56A27
Position
5
AA seq 790 aa
MSRRRHSYENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEAD
LPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANN
YNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEEDVPQVRRDWYVYAFLSSLPWV
GKELYEKKDAEMDRIFSSTESYLKRRQKTHVPMLQVWTADKPHPQEEYLDCLWAQIQKLK
KDRWQERHILRPYLAFDSILCEALQHNLPPFTPPPHTEDSVYPMPRVIFRMFDYTDDPEG
PVMPGSHSVERFVIEENLHCIIKSYWKERKTCAAQLVSYPGKNKIPLNYHIVEVIFAELF
QLPAPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLYMRLDTMSTTCVDRFINWFSHH
LSNFQFRWSWEDWSDCLTQDLESPKPKFVREVLEKCMRLSYHQHILDIVPPTFSALCPAN
PTCIYKYGDESSNSLPGHSVALCLSVAFKSKATNDEIFSILKDVPNPNQVDDDDEGFRFN
PLKIEVFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAESDKGKLHVLRVMFEVWRNHPQM
IAVLVDKMIRTQIVDCAAVANWIFSSELSRDFTRLFVWEILHSTIRKMNKHVLKIQKELE
EAKEKLARQHKRRSDDDDRGSDRKDGALEEQIERLQEKVESAQSEQKNLFLVIFQRFIMI
LTEHLVRCETDGTSILTPWYKNCIERLQQIFLQHHQIIQQYMVTLENLLFTAELDPHILA
VFQQFCALQA
NT seq 2373 nt   +upstreamnt  +downstreamnt
atgtcgcggaggcggcacagctacgagaacgatggtggacaacctcacaaaaggaggaag
acatcagatgcaaatgaaacggaagatcatttggaatctttaatatgcaaagtaggggaa
aagagcgcttgctctttagagagcaatctcgaaggcctggctggtgttttagaagctgat
cttcctaactacaagagcaagatcttaaggctcctttgtacagttgcacgtctgttacct
gagaagctaacaatttatacaacattagttggactgctgaatgccagaaattataacttt
ggaggagaatttgtagaagctatgattcgtcaacttaaagaatcgctaaaagcaaacaac
tataatgaagctgtatatttggtccgttttctgtctgatcttgtgaactgtcatgtgatt
gctgccccatctatggttgctatgtttgagaattttgtaagtgtaactcaggaagaagat
gtgcctcaagtgcgacgggattggtatgtgtacgcgtttctgtcatccttgccctgggtt
gggaaggagttgtatgaaaagaaagatgcagaaatggaccgcatcttctccagcaccgaa
agctatctcaaaagacgccagaagactcatgtgcccatgttacaagtatggactgccgat
aagccacacccccaagaagagtatttagattgcctgtgggcccagattcagaaattgaaa
aaggaccggtggcaggaaaggcacatcctaagaccctaccttgcctttgacagcatcctc
tgtgaagcactacagcacaacctgcctcctttcacaccaccgcctcacaccgaagactcc
gtgtacccaatgcccagggtcatcttcaggatgtttgactacacagacgacccagagggt
cctgttatgccagggagccattcagtagagaggtttgtcatagaggagaatcttcattgc
atcataaaatcctactggaaggaaaggaaaacttgtgctgcccagttggtgagttatcca
ggcaagaacaagatcccattgaactaccacatagtggaggtgatctttgcagagctgttt
cagcttccagcgcctccgcacattgatgtgatgtacacgacactgctgatcgaactgtgc
aaacttcagccgggctctctgccccaagtgcttgcacaggccactgagatgctgtacatg
cgtctggacaccatgagtaccacgtgtgttgacaggtttattaattggttttctcatcat
ctaagtaattttcaattccgctggagctgggaagattggtcagattgtcttactcaggat
cttgaaagtcccaaaccaaagtttgtaagagaagttctagagaaatgtatgaggttgtct
taccatcagcatatattagatatcgttcctcccaccttctcagctctgtgtcctgcaaac
ccaacctgcatttacaagtatggagacgaaagtagcaattctcttcctggacattccgtg
gcactctgtttatctgttgcttttaaaagtaaggcaaccaacgatgaaatcttcagcatt
ctgaaggacgtaccaaatcctaaccaggttgatgatgacgatgaagggttcagatttaat
cccttgaaaatagaagtctttgtccagactctgctgcacttagctgccaagtccttcagt
cactccttcagtgctcttgcaaagtttcatgaagtcttcaaaactctagcagaaagtgat
aaggggaagctgcatgtgctgagagtcatgtttgaagtctggaggaatcacccgcagatg
attgctgtactggttgataagatgattcgtacacagattgttgactgtgctgcagtagca
aactggatcttctcatcagagctgtctcgtgactttacgaggttgtttgtgtgggaaatt
ttgcactctacaattcgtaagatgaataagcatgttctgaagatccagaaagagctggaa
gaagctaaagagaaactagcaaggcagcacaaacgacgcagtgatgatgatgaccggggc
agcgacaggaaggacggtgccctggaggagcaaatcgaaaggctgcaggagaaagtggag
tctgctcagagcgagcaaaagaaccttttcctcgtcatcttccagcgtttcatcatgatc
ttgactgaacacttggtgcgctgtgaaaccgatgggaccagtatattgaccccgtggtat
aagaactgcatcgagaggctgcagcagatcttcctacagcatcaccagataatccagcag
tacatggtgaccctggagaacctgctcttcacggcagagttagatcctcacatcctggct
gtgttccagcagttctgtgctctgcaggcctaa

DBGET integrated database retrieval system