KEGG   Rattus norvegicus (rat): 298086
Entry
298086            CDS       T01003                                 

Gene name
Zcchc7
Definition
(RefSeq) zinc finger CCHC-type containing 7
  KO
K12597  protein AIR1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    298086 (Zcchc7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    298086 (Zcchc7)
   03016 Transfer RNA biogenesis [BR:rno03016]
    298086 (Zcchc7)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    TRAMP complex
     298086 (Zcchc7)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  tRNA degradation factors
   TRAMP complex
    298086 (Zcchc7)
SSDB
Motif
Pfam: zf-CCHC zf-CCHC_3
Other DBs
NCBI-GeneID: 298086
NCBI-ProteinID: NP_001100128
RGD: 1310467
Ensembl: ENSRNOG00000013078
UniProt: B1WC15
Position
5q22
AA seq 542 aa
MFGGFETIEAFEDDLYRDDSSSELSVDSEVEFQLYSQVHYSQNIHNANEEEGYEEKNCES
SETVSIQPDQKNLIVLSDSEVIQLSDTSEVITLSDEDSIYRCKRKNIEVQAQEKTQSPAT
PRSNKVANKCKRSNKKPEPEESPSTIREVMIIEVSSDEEEESTISENENVESWMLLGCEE
DDKDNDILLNLVGCKDAGAEGENDVNWFISDKDIEAKIDNNRSSGRWNNRYYSVNKNVTC
RNCDKRGHLSKNCPLPQKVRPCCLCSERGHLQYGCPARYCLDCSLPMSSTHRCFERSSWR
KRCDRCDMIGHYADACPEIWRQYHLTTKPGPPKKPKTPSGQSALVYCYNCAQKGHYGHEC
TERRMFNQAFPTSPFIYCYDDKYDIQQRDRRIKRKLKDIKKNGDFPRQFKRPHGEETDRY
HHDRRKSRFSGKRSRWPRESKETQKEKTRGREGEKHRRDRQPRDEDEDFPRGLKPNSSSS
SNSQKPSKSLHQASHYHRLREEKLRRESMRSKPKKRKFVEDGSHDDLFLIKQRKKKPKSS
GF
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgtttggtggctttgagactatagaagcattcgaagatgacctttatcgtgatgattca
tctagtgaacttagtgttgatagtgaagtggaatttcagctctacagccaagtccattat
tcccagaatattcataatgccaacgaggaggaagggtatgaggaaaagaactgtgagagt
tctgaaacagtgagtattcaaccagaccagaagaacttaatcgtcctttcagatagtgag
gtcatccagctgtcagatacatcagaggtcatcacattgtctgatgaagatagtatttat
agatgtaagagaaaaaatattgaagtccaagcacaagaaaagacccaaagtcctgcaacg
cctcgttctaataaagtggctaacaaatgcaagaggagtaataagaagcctgaacctgaa
gagagcccaagtacgatccgagaggtcatgatcatagaggtcagctcagatgaggaggaa
gaaagtaccatttcagagaatgaaaatgtggaaagctggatgctcctgggatgtgaggaa
gatgataaagacaatgacatccttctcaacctggtgggatgcaaggacgctggtgctgaa
ggagaaaatgatgtaaattggttcatcagtgacaaagacatcgaggccaagatagataac
aacagatcatctggaaggtggaacaaccgatactattcagtcaacaaaaatgtcacgtgt
agaaattgtgataaacgtggccatttgtcaaaaaactgccccttaccacaaaaagtccgg
ccctgctgtctctgctcggaaagaggacacctccagtatggctgtccagcccgttactgc
ttagactgctctttgcccatgtcttccactcacagatgttttgaaagatcttcctggaga
aagcgatgtgaccgatgtgatatgataggccactatgctgatgcttgcccagaaatctgg
aggcagtatcacctaacgaccaaacctggaccacctaaaaagccaaagaccccttctgga
caatcagcgctggtgtattgctacaactgtgcacagaaaggccattatggacatgaatgt
acagagagacggatgtttaaccaggcgtttccaacatctccattcatatattgctatgac
gacaaatacgacatccagcaaagggatcggagaataaaacggaaactgaaagatatcaag
aaaaatggagattttccaaggcagttcaaaagaccacatggagaagagacagatagatat
caccatgataggagaaaaagccgtttctcaggaaaacgcagtcggtggcctcgagaaagt
aaggaaacgcagaaagagaagaccaggggtagagaaggcgagaagcacaggagggaccgc
cagcctcgcgatgaggatgaagacttccctaggggcctgaaacccaactcctccagcagc
agtaacagccagaagccttctaagtccctccaccaggcatcccattaccacaggctgagg
gaagagaagcttcgcagagagagcatgcggagcaagccgaagaaaaggaaattcgtagag
gatggcagccatgatgatttatttcttattaagcaaaggaagaagaaacctaagtccagt
ggtttctga

DBGET integrated database retrieval system