KEGG   Rattus norvegicus (rat): 298199
Entry
298199            CDS       T01003                                 

Gene name
Plin2, Adfp, Adrp
Definition
(RefSeq) perilipin 2
  KO
K17284  perilipin-2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    298199 (Plin2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    298199 (Plin2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   298199 (Plin2)
SSDB
Motif
Pfam: Perilipin GlutR_dimer Bacillus_HBL
Other DBs
NCBI-GeneID: 298199
NCBI-ProteinID: NP_001007145
RGD: 728889
Ensembl: ENSRNOG00000007060
UniProt: Q5U2U5
Position
5q32
AA seq 422 aa
MASVAVDPQPSVVTRVANLPLVSSTYDLVSSAYVSTKDQHPYLRSVCEMAEKGVRTVTSV
AVTGALPIIQKLEPQIAVANTYACKGLDRMEARLPILNQPTSEIVANARGAVTGAKDVVT
TTMAGAKDSVASTVSGVVDKTKGAVTGSVERTKSVVNGGIDTVLGMVQLMSSGVENAISK
SELLVDQYLPLTQKELEMEAKKVEGFDMVQKQRYYERLESLSTKICTRAYHQALGRIKDA
KQKGQETISQLHSTVHLIEFARKNVHSANQKIQDKLSVSWVEWKRIVGYDDTDESHCAEH
IESHTLSMARNLTQQLHTTCQTLLFNVQGLPQNIQDQAKHLGVMAGDIYSAFRNVTSFKE
VSDGVLTSSKGQLQKMKESLDEVMDYLVNNTPLNWLVGPFYPQSTEVDKASLKVQQSELT
TQ
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggcatcagtagcagtggatccacaaccgagcgtggtgacgagggtggccaacctgccc
ttggtgagctccacctacgacctggtgtcctccgcttatgtcagtacaaaggatcagcac
ccgtatttgaggtcagtgtgtgagatggcagagaagggagtgaggaccgtgacctcagtg
gctgtgacaggcgcactgcccatcatccagaagctggagccacagattgcggtcgccaat
acctatgcctgcaaggggctagacaggatggaggcaaggctgcctattctgaaccagcca
acatctgagattgttgccaatgcccgaggtgccgtaactggggcaaaggatgtagtgacg
actaccatggctggagccaaggattctgtagccagcacagtctcaggggtggtggataag
accaaaggagcagttactggcagcgtggaaaggaccaagtctgtggtcaatggcggcatc
gacacggttttggggatggtgcagctcatgagcagtggagtggaaaatgcaattagcaag
tcggagctgctggtagaccagtacttgccgctcactcagaaggagctcgagatggaagca
aaaaaggtggaaggatttgatatggttcagaagcaaagatactatgaacggctggagtcc
ctgtctaccaagatctgcacccgggcctatcatcaggctctcggcaggatcaaagacgcc
aaacaaaagggccaggagaccatttcccagctccactccactgtccatctgattgaattc
gccaggaagaatgtgcacagtgctaaccagaaaattcaggacaagctctctgtctcatgg
gtggagtggaagagaatcgtcggctacgacgacacggacgagtcccattgtgctgagcac
atcgagtcacatactctgtctatggcccgcaacctgacccagcagctccacactacatgc
cagacgctcctgttcaacgtccaagggttaccacagaacattcaagaccaggccaaacac
ttgggggtgatggcaggtgacatctactcggcgttccgcaatgttacctccttcaaggaa
gtgtctgatggcgtcctcacttctagcaaggggcagctgcagaaaatgaaggagtcctta
gatgaagttatggattaccttgttaacaacacgcctctcaactggctggtaggtcccttt
tatcctcagtctaccgaggtggacaaggccagcctgaaggtccagcagtctgagctcaca
actcagtaa

DBGET integrated database retrieval system