KEGG   Rattus norvegicus (rat): 298227
Entry
298227            CDS       T01003                                 

Gene name
Mtap
Definition
(RefSeq) S-methyl-5'-thioadenosine phosphorylase precursor
  KO
K00772  5'-methylthioadenosine phosphorylase [EC:2.4.2.28]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00270  Cysteine and methionine metabolism
rno01100  Metabolic pathways
Module
rno_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    298227 (Mtap)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.28  S-methyl-5'-thioadenosine phosphorylase
     298227 (Mtap)
SSDB
Motif
Pfam: PNP_UDP_1
Other DBs
NCBI-GeneID: 298227
NCBI-ProteinID: NP_001041332
RGD: 1310114
Ensembl: ENSRNOG00000006615
UniProt: Q7TP15
Position
5
AA seq 391 aa
MEVGGRCWLILLALGLIAPQSPLGPALRPAVDFPGADMASGSACTAVKIGIIGGTGLDDP
EILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLASMYVLDRMCEFLLLPFCVQLNSLH
EIPPGSSCHTSYLFAFVARWERRVRWLARVLCERAFVPSSASTSVQWKETKHSKEITQRS
KASRFSTTVQQQAIREECQTSLRPQTFYDGSHCSARGVCHIPMAEPFCPKTREVLIEMAK
KLGLRCHSKGTIVTIEGPRFSSRAESFIFRTWGADVINMTTVPEVVLAKEAGLCYASIAM
ATDYDCWKEHEEAVSVDGVLKTMKENANKAKSLLLTTIPQIGSMEWSETLRNLKVVAVKL
YGEKKRELHQKSSGGMLQMLASSKDSGQLAE
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggaagtcggcggcagatgctggctgatactcttggctttgggattgattgccccgcag
tctccccttggtccagcgctgcggcccgccgtggacttccccggtgcagacatggcctcg
ggctccgcctgcacggcagtgaagattggaataattggtggaacaggcttggatgaccct
gaaattttagaaggaagaacagaaaaatatgtggatactccatttggcaagccatctgat
gccttaattttggggaagataaagaacgtcgactgtgtgcttcttgccagcatgtacgtt
ttagatcgtatgtgtgagttcctgctgctgcctttctgtgtccagcttaattcacttcac
gagattcctccaggctcatcttgtcacacctcttatctgtttgcgtttgttgcccgctgg
gaaaggcgtgtccgctggttagcgagagttctctgtgagcgggcctttgtgccgagctca
gcatctacttccgttcagtggaaagaaaccaaacattcgaaggagataacgcaaagatcc
aaagcatccaggttctccacgacagtgcaacagcaggctatccgagaggagtgccagaca
tccctgaggcctcagaccttctatgatggaagtcattgcagtgccagaggagtgtgccac
atcccaatggctgaaccattttgccccaaaacaagagaggtcctcatagaaatggctaag
aagcttggactccggtgccattcaaaggggacgatagtcacaattgaggggcctcggttt
agctcccgggcagaaagctttatattccgtacttggggcgcagatgttatcaatatgacc
actgttccagaggtggtgcttgcaaaggaggccggattgtgctacgcaagcattgccatg
gcaaccgattatgattgctggaaggagcatgaagaagcagtgtcagtggatggggtttta
aagaccatgaaagaaaatgccaataaagccaaaagtttactcctaactactatacctcag
atagggtcaatggaatggtcagaaacgctccgtaacctaaaggtggttgctgtcaagctg
tatggagaaaaaaagagagagctgcaccaaaaatcgtctggcggtatgctgcagatgctt
gcctcttccaaggactctggacaattggcagagtga

DBGET integrated database retrieval system