KEGG   Rattus norvegicus (rat): 298298Help
Entry
298298            CDS       T01003                                 

Gene name
Dhcr24
Definition
(RefSeq) 24-dehydrocholesterol reductase
  KO
K09828  Delta24-sterol reductase [EC:1.3.1.72 1.3.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00100  Steroid biosynthesis
rno01100  Metabolic pathways
Module
rno_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    298298 (Dhcr24)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.72  Delta24-sterol reductase
     298298 (Dhcr24)
    1.3.1.-  
     298298 (Dhcr24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_4
Motif
Other DBs
NCBI-GeneID: 298298
NCBI-ProteinID: NP_001073617
RGD: 1306529
Ensembl: ENSRNOG00000006787
UniProt: A1KXK4
Position
5q34
AA seq 516 aa AA seqDB search
MEPAVSLAVCALLFLLWVRVKGLEFVLIHQRWVFVCLFLLPLSLIFDIYYYVRAWVVFKL
SSAPRLHEQRVQDIQKQVREWKEQGSKTFMCTGRPGWLTVSLRVGKYRKTHKNIMINLMD
ILEVDTKKQIVRVEPLVSMGQVTALLNSIGWTLPVLPELDDLTVGGLIMGAGIESSSHKY
GLFQHICTAYELILADGSFVRCTPSENSDLFYAVPWSCGTLGFLVAAEIRIIPAKKYVKL
RFEPVRGLEAICEKFTHESQRLENHFVEGLLYSLDEAVIMTGVMTDDVEPSKLNSIGSYY
KPWFFKHVENYLKTNREGLEYIPLRHYYHRHTRSIFWELQDIIPFGNNPIFRYLFGWMVP
PKISLLKLTQGETLRKLYEQHHVVQDMLVPMKCLSQALHTFQNDIHVYPIWLCPFILPSQ
PGLVHPKGDEAELYVDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE
FWEMFDGSLYHKLRKQLGCQDAFPEVYDKICKAARH
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgccgtgtcgctggccgtgtgcgcgctgctctttctgctctgggtgcgagtg
aaggggttggagttcgttctcatccaccaacgctgggtgtttgtgtgcctcttcctgcta
ccgctctccctcatcttcgacatctactactacgtgcgcgcctgggtggtgttcaagctg
agcagtgcgccgcgcttgcacgagcagcgcgtgcaggacatccagaaacaggtacgggag
tggaaggagcagggcagtaagaccttcatgtgcacggggcgtcctggatggctcactgtc
tcactgcgggttgggaagtacaggaagacgcataagaacatcatgatcaacctgatggac
attctggaggtggacaccaagaaacagattgtgcgagtggagcccttggtgtctatgggt
caggtgacagctttgctgaactccattggctggactctgcctgtgttgcctgaactcgat
gacctcacagtggggggcctgatcatgggcgccggcatcgagtcatcgtcccacaagtat
ggcctgttccaacacatctgtacggcctacgagctaatcctggcagatggcagctttgtg
cgctgcacaccgtctgaaaactcagacctgttctatgccgtaccctggtcctgtgggacc
ctgggcttcctggtggctgctgagatccgcatcatccctgccaagaagtatgtcaagctg
cggtttgagccagtgcggggcctggaggccatctgtgagaaattcacccatgagtcccag
cggctggagaaccacttcgtggaagggttgctgtattccttggatgaggctgtcatcatg
acaggggtcatgacggatgatgtagagcccagcaagctgaatagcattggcagttactac
aagccgtggttcttcaagcatgtggagaactacctgaagacaaaccgagagggccttgaa
tacattcccctgaggcactactaccaccgccacacgcgcagcatcttctgggagctccag
gacatcatcccttttggcaacaaccccatcttccgctacctctttggctggatggtgcct
cccaagatctccctcctgaagctgacccagggcgagactctgcgtaaactgtatgaacag
catcatgtggtacaggacatgctggtacccatgaaatgcctgtctcaggccctgcatacc
ttccaaaatgacatccacgtctaccccatctggctgtgcccgttcatcctgcccagccag
ccaggacttgtgcatcccaagggagatgaggctgaactctacgtggacatcggggcatat
ggggagccacgggtgaagcacttcgaggccaggtcctgcatgaggcagctggagaagttt
gtgcggagcgtgcacgggttccagatgttatacgccgattgctatatgaaccgggaggaa
ttctgggagatgttcgatggctccttgtaccacaagctgcgcaagcagcttggctgccag
gacgccttccctgaggtgtatgacaagatctgcaaggcggcaaggcactga

DBGET integrated database retrieval system