KEGG   Rattus norvegicus (rat): 298322Help
Entry
298322            CDS       T01003                                 

Gene name
Lonrf3, RGD1565451
Definition
(RefSeq) LON peptidase N-terminal domain and ring finger 3
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: LON_substr_bdg zf-C3HC4_2 zf-C3HC4_3 zf-C3HC4_4 TPR_2 zf-RING_5 zf-C3HC4 zf-RING_UBOX TPR_11 zf-RING_2 TPR_16 zf-rbx1 Prok-RING_4 zf-RING_10 TPR_9 U-box zf-RING_6 MCM_bind zf-RING_4 ANAPC3
Motif
Other DBs
NCBI-GeneID: 298322
NCBI-ProteinID: NP_001178514
RGD: 1565451
Ensembl: ENSRNOG00000013092
UniProt: D3ZER0
Position
Xq35
AA seq 757 aa AA seqDB search
MDSLQTAQMVSLSAELGSNNLELAEPEEPAASMAVGESAAHSEKVTPEGSQPPGAQEPEQ
SQPLAASTPPECKVLLTQADALASRGHLREALEVYRQLSERQQLVAEQLEQLVRCLADSI
PQDELMAPAPADPSATSSCCAAALKKAGEAAAVAPEVWDGFKCRKCHGFLSDPVSLWCGH
TFCKLCLERGRAADRRCALCGVKLSALMVASGRARGPRRSGPQAPLQLRVNVVLSGLLGK
LFPGPARASQLRHEGNRLYRERQVEAALLKYNEAVRLAPNDHLLYSNRSQIYFTLESHED
ALHDAEIACKLRPMGFKAHFRKAQALATLGKVKEALREFLYCVSLDGKNKRARSEAQREN
SELPHCSNQEGAAAREESSSLVNMAQGKVSRKEDRAKSQEEEEQDAASVRTGKCLEKKRN
RCQIETQEDTELPNKVSKQDLPAEQGAKPDLSIPLGSFDASDLECSLCMRLFYEPVTTPC
GHTFCLKCLERCLDHNAKCPLCKDVLLQCLPSRKYSKNVIMEELIAKFLPEELKERRRLY
EEEMEELSNLNKNVPIFVCTMAYPTVPCPLHIFEPCYRLMIRRCIETGTKQFGMCLGDPV
KGFAEYGCILEIRNVQFFSDGRSVVDSIGKRRFKVLHQGQRDGYNTADIEYIEDQKVQGD
DCAELVGLHNCVYEQASSWFHSLKTSLKNRILNHFGPMPEKDEDPQVNPNGPAWCWWTLA
VLPLESRAQLPFLAMRSLKDRLNGIRRILAFISRNQN
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atggattcccttcagaccgcacagatggtgagcttgtccgccgagctcggcagcaacaac
ttggagctggcggagccggaggagccggcggcatcgatggccgtaggagagtcagccgcc
cactcggagaaggtgacacccgagggctcccaacctcccggggctcaagagcccgagcaa
agccagcctctggcggcctcgacgccgccggagtgcaaagtcctgctcacgcaggcggat
gccttggcatcccgggggcaccttcgggaagccctcgaggtgtaccgacagctctccgag
aggcagcagctcgtggcggagcagctggagcagctagttcgctgcctggccgacagtatc
ccgcaagacgagctgatggcgccagctcctgcagacccgagcgccacttcgagctgctgc
gcagcggcgctgaaaaaggcaggggaggccgcggccgtggcccccgaggtatgggatggc
tttaagtgcaggaagtgtcacgggttcctctccgacccggtgtccctgtggtgcggccac
accttttgtaaactgtgcctggagcgcgggcgagccgccgataggcgctgcgctctgtgc
ggggtcaagctctccgcactcatggtggccagtgggagggcacgcgggccgcggcgctcg
gggccgcaggcgccactgcaactgcgagtcaacgtggtactcagcggtctcctgggcaag
ttgttcccgggccccgcgcgagcgtcgcaactccggcacgagggcaaccggctgtaccgt
gagcgccaggtggaggcggctctgctcaagtacaacgaggctgttcgtctagctccaaat
gaccatttgctttatagcaatcggtcccaaatttatttcaccttggagtctcatgaggat
gcactgcatgatgcagaaatagcatgtaaactacggccaatgggttttaaggcacacttc
agaaaagcacaagctttagccaccctaggcaaggtgaaagaagcactcagagaatttctc
tactgtgtatcccttgatggaaagaacaagagagccagatctgaagcgcaaagggagaat
tcagagcttccccattgttctaatcaggagggagcagcagctagggaagaaagcagcagc
ctagtgaacatggctcaaggaaaggtgagtagaaaagaagacagagcgaaaagtcaggaa
gaagaggaacaagatgctgcctccgtcaggaccggcaaatgcctggaaaagaagaggaat
cgttgccaaattgaaacccaagaagacacagaattgcctaataaagtctccaaacaagat
cttcctgctgagcagggggccaaaccggatctcagtattccacttggatcttttgatgca
tctgaccttgaatgctcactgtgtatgagattgttctatgagccagtcacaacaccttgt
gggcacaccttttgcttgaaatgtcttgagagatgcctggatcataatgcaaagtgtcca
ctgtgcaaagacgttcttttacagtgcttgccatcaagaaaatacagcaagaatgtaata
atggaagaactcatagctaagttcctaccagaagaactcaaggaacgaagaaggctttat
gaagaagaaatggaagagctttctaacttaaataagaatgtgcccattttcgtgtgtacc
atggcctatcccaccgttccttgtcccttgcacatctttgagccttgttaccgcctgatg
attcgaagatgtattgagacaggcacaaaacagtttggcatgtgccttggagatcctgtc
aaagggtttgcagaatatggctgcatcttggagatcagaaatgtccaattcttttctgac
ggccgatcagtggttgacagcataggcaagaggcgcttcaaagtgctccatcagggtcaa
cgggatggctacaacactgctgacattgaatacattgaagatcaaaaggttcagggagac
gattgtgctgaactcgtgggattgcataactgtgtgtacgagcaagcgtcatcatggttt
cattcactcaaaacatcgctgaagaatcggatactaaatcactttggcccaatgccagag
aaggatgaagacccccaggtcaatccgaatggtccagcctggtgctggtggacactggcg
gttcttcccctggaaagcagagctcagcttcccttcctagcaatgaggtccttaaaggat
agactgaatggtatccggcgtatcctggcctttatatcgagaaaccaaaattaa

DBGET integrated database retrieval system