KEGG   Rattus norvegicus (rat): 298370
Entry
298370            CDS       T01003                                 

Gene name
Txndc12, RGD1305960
Definition
(RefSeq) thioredoxin domain containing 12
  KO
K05360  protein-disulfide reductase (glutathione) [EC:1.8.4.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    298370 (Txndc12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    298370 (Txndc12)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.2  protein-disulfide reductase (glutathione)
     298370 (Txndc12)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    298370 (Txndc12)
SSDB
Motif
Pfam: Thioredoxin_7 Thioredoxin Thioredoxin_2 Thioredox_DsbH Thioredoxin_9 Thioredoxin_8 Glutaredoxin AhpC-TSA
Other DBs
NCBI-GeneID: 298370
NCBI-ProteinID: NP_001094310
RGD: 1305960
Ensembl: ENSRNOG00000008090
UniProt: Q498E0
Position
5q34
AA seq 170 aa
MSLRFGATCLLSFSFLLLITSSDGRTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIH
KSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSG
KVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQVRLTGDAFREKHFQDEL
NT seq 513 nt   +upstreamnt  +downstreamnt
atgtcgcttcgtttcggggccacctgtttgctgagcttcagtttcctgctcctcatcact
tcttcagacggacgcactgggcttggaaagggttttggagatcatattcactggaggact
ctagaagatgggaagaaagaagcagctgcaagtggcttgccgctgatggtgatcatccac
aagtcttggtgtggagcctgcaaagctttaaaacccaaatttgcagaatctacagaaatt
tcagaactgtcccataatttcgttatggtaaatctggaggatgaagaggaacccagggat
gaagacttcagtcctgatgggggttatattccgcgcatccttttcttggatcccagtggc
aaggtgcgccctgaaatcatcaatgagagtggaaaccccagctacaagtatttctacgtc
agtgctgagcaagttgttcaagggatgaaggaagcacaggtgaggctgactggtgatgcc
ttcagagagaaacattttcaggatgaattgtga

DBGET integrated database retrieval system