KEGG   Rattus norvegicus (rat): 298376
Entry
298376            CDS       T01003                                 

Gene name
Gpx7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
rno04918  Thyroid hormone synthesis
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    298376 (Gpx7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    298376 (Gpx7)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    298376 (Gpx7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    298376 (Gpx7)
   05016 Huntington disease
    298376 (Gpx7)
   05022 Pathways of neurodegeneration - multiple diseases
    298376 (Gpx7)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     298376 (Gpx7)
SSDB
Motif
Pfam: GSHPx AhpC-TSA
Other DBs
NCBI-GeneID: 298376
NCBI-ProteinID: NP_001100143
RGD: 1306999
Ensembl: ENSRNOG00000009751
UniProt: D3ZQI1
Position
5q34
AA seq 186 aa
MVAAVATAWLLLWAAACTQSEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTD
QNYRALQQLQRDLGPYHFNVLAFPCNQFGQQEPDSNREIENFARRTYSVSFPMFSKIAVT
GTGAHPAFKYLTQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVPVEEIKPRITEQVMKLIL
QKREDL
NT seq 561 nt   +upstreamnt  +downstreamnt
atggttgcggctgtggcgacggcgtggctgctcctgtgggccgcggcctgcacgcaatcc
gagcaagacttctacgacttcaaggcggtgaacatccggggcaagctggtgtcgctggag
aagtaccgcggctcggtttccctggtggtgaatgtagctagcgaatgtggcttcacagac
cagaactaccgagccttgcagcagctgcagcgggacctgggcccctaccattttaacgtg
cttgctttcccttgcaaccagtttggccaacaggaaccagacagcaacagggagattgag
aactttgcccgccgcacctacagtgtctctttccccatgtttagcaagatcgcagtcact
ggcactggtgcccaccctgccttcaaatacctaacccaaacttctgggaaggagcccacc
tggaacttctggaagtacctagtggccccagacggaaaggtggtgggggcatgggatccc
actgtgccggtggaggagatcaagccccgtattacagagcaggtgatgaagctcatcctt
cagaaacgagaagacttgtga

DBGET integrated database retrieval system