KEGG   Rattus norvegicus (rat): 298385
Entry
298385            CDS       T01003                                 

Gene name
Magoh
Definition
(RefSeq) protein mago nashi homolog
  KO
K12877  protein mago nashi
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    298385 (Magoh)
  09122 Translation
   03013 RNA transport
    298385 (Magoh)
   03015 mRNA surveillance pathway
    298385 (Magoh)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    298385 (Magoh)
   03041 Spliceosome [BR:rno03041]
    298385 (Magoh)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     298385 (Magoh)
Spliceosome [BR:rno03041]
 Complex C
  Other components
   EJC/TREX
    298385 (Magoh)
SSDB
Motif
Pfam: Mago_nashi
Other DBs
NCBI-GeneID: 298385
NCBI-ProteinID: NP_001094006
RGD: 1305174
Ensembl: ENSRNOG00000012778
UniProt: Q27W02
Position
5
AA seq 146 aa
MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEEL
KRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLR
VFYYLVQDLKCLVFSLIGLHFKIKPI
NT seq 441 nt   +upstreamnt  +downstreamnt
atggagagtgacttttacctacgttactacgtgggtcacaaaggcaagtttggtcatgag
ttcctggagtttgaattccgacctgacggtaaattgcgatatgccaacaacagcaattac
aaaaatgatgtcatgatcaggaaagaggcttatgtacataagagtgtgatggaagaatta
aagaggattattgacgacagtgagatcaccaaagaagatgacgctctgtggccccctcct
gatcgagtgggccggcaggaactcgaaattgtcattggagatgagcacatttcttttaca
acatcaaaaattggttcccttattgatgtcaaccagtccaaggatccagaaggcttgcga
gtgttttattatcttgtccaggacctgaagtgtttagtcttcagccttattggattacac
ttcaagatcaagccaatctag

KEGG   Rattus norvegicus (rat): 690303
Entry
690303            CDS       T01003                                 

Gene name
Magohb
Definition
(RefSeq) protein mago nashi homolog 2
  KO
K12877  protein mago nashi
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    690303 (Magohb)
  09122 Translation
   03013 RNA transport
    690303 (Magohb)
   03015 mRNA surveillance pathway
    690303 (Magohb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    690303 (Magohb)
   03041 Spliceosome [BR:rno03041]
    690303 (Magohb)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     690303 (Magohb)
Spliceosome [BR:rno03041]
 Complex C
  Other components
   EJC/TREX
    690303 (Magohb)
SSDB
Motif
Pfam: Mago_nashi
Other DBs
NCBI-GeneID: 690303
NCBI-ProteinID: NP_001178034
RGD: 1597384
Ensembl: ENSRNOG00000010316
UniProt: F1M0X6
Position
4
AA seq 148 aa
MALASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVME
ELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEG
LRVFYYLVQDLKCLVFSLIGLHFKIKPI
NT seq 447 nt   +upstreamnt  +downstreamnt
atggctttggctagtgatttctacctgcggtactacgtcgggcacaagggcaagtttggg
cacgagtttctggagttcgagtttcggccggacgggaagcttagatatgccaacaacagc
aattataaaaatgatgtgatgatcagaaaagaggcttatgtccacaagagtgtaatggaa
gaactgaaaaggatcattgacgacagtgaaattacaaaggaggacgacgctctgtggccg
cctcctgacagggttggccggcaggaacttgaaatcgtaatcggggatgaacacatttct
tttaccacatcaaaaataggttctctcattgatgtaaatcagtcaaaagatcccgaaggc
ctccgtgtattttactatttggtgcaagacctgaaatgtttagtgttcagcctcattggt
ctacacttcaagattaagccgatttga

DBGET integrated database retrieval system