KEGG   Rattus norvegicus (rat): 298392Help
Entry
298392            CDS       T01003                                 

Gene name
Ccin
Definition
(RefSeq) calicin
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: BTB Kelch_1 Kelch_6 Kelch_4 BACK Kelch_2 Kelch_3 Kelch_5
Motif
Other DBs
NCBI-GeneID: 298392
NCBI-ProteinID: NP_001005904
RGD: 1359369
Ensembl: ENSRNOG00000014831
UniProt: Q5XI58
Position
5q22
AA seq 588 aa AA seqDB search
MKLEFTEKNYNSFVLQNLNKQRKRKEYWDMALTVDHHVFFAHRNVLAAVSPLVKSLVSSN
DMKTTDELYITIDPNYLSPATVDQLLDYFYSGKVVISEQNVEELLRGAQYFNTPRLRIHC
NDFLIKSIRRVNCLRYLFLAELFELKEVSDLAYSGIRDNFHFWASPEGSMHFMRCPPVIF
GRLLRDENLHVLNEDQALSALINWVYFRKEEREKYFKKFFNYINLNAVSNKTLMFASNKL
TGLENNSAHATLIESVLMDRKQERPCSLLSYQRKGALLDSVVILGGQKAHGKFNDGVFAY
IIQENLWLKLSEMPYRAAALSATAAGRYIYISGGTTEQISGLKTAWRYDMDDNSWTKLPD
LPIGLVFHTMVTCGGTVYSVGGSIAPRRYVSNIYRYDERKEAWCLAGKMSIPMDGTAVIT
KGDRNLYIVTGRCLVKGYISRVGVVDCFDTCTGEVVQCITFPIEFNHRPLLSFHQDNILR
VHSHRQSVEINLQKIKANKSTTSVPLLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQ
TKDYTINPNAYLLDQKIGEWKTLACPPEALDCPACCLAKLPCKILQRI
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggaattcacagagaaaaactacaacagctttgtgctgcaaaacctgaataaa
cagaggaagcgcaaagagtactgggacatggccctgactgtggaccaccatgtcttcttc
gcacatcgcaacgtgctggctgccgtctctccactggtgaaaagtcttgtctccagcaac
gacatgaagaccaccgatgaactctacatcaccattgaccccaactacctgagtccagcc
acggtggaccagctcctggactacttctacagcggcaaagtggtgatctcagaacagaat
gtggaggagctgctccgtggcgctcagtatttcaataccccacgccttcggattcactgc
aatgacttcctgattaagtccattcgacgcgtcaactgcttgcgctacctcttcttggct
gagctgttcgagcttaaagaagtatcagacttggcctactctggcattcgcgacaacttc
cacttctgggccagtcccgagggctctatgcacttcatgcgctgcccacctgtcatcttc
ggccgcctgctccgtgatgaaaaccttcacgtgctcaacgaggaccaggctctcagcgca
ctcatcaattgggtgtacttccggaaggaggagcgggaaaaatacttcaagaagttcttc
aattacatcaacctcaatgctgtctccaacaagacgctgatgtttgccagcaacaagctg
actggcttggagaacaactcggcccacgcgaccttaatcgaaagtgtcctgatggaccgc
aagcaggagcgcccgtgcagcctgctgagctaccagcggaaaggggccctgcttgattca
gtggtcatcctgggtggccagaaggcccatggcaagttcaacgacggagtgtttgcgtat
atcatccaggagaacctgtggctgaagctctcagagatgccataccgagcagccgcgctc
agtgccactgctgctggccgttacatctacatatctggtggcaccactgagcagatttca
ggactgaagacagcatggcggtatgatatggatgacaactcctggaccaagctgcctgac
ctgcccattgggcttgtcttccacaccatggtgacctgtgggggaacagtttactcagtg
ggtgggagcattgccccacgccggtacgtctctaacatctatcgctacgatgaacgcaag
gaagcctggtgcttggcaggcaagatgagcatccctatggacgggactgcagtgatcact
aagggtgaccggaacctgtacattgtcaccgggcgatgcctggtgaagggctacatctcc
cgggtcggtgtggtggactgcttcgacacctgtacaggggaagtggtccagtgtatcact
ttccccatcgaattcaaccaccggcccctgctctccttccaccaggacaatatcctccgt
gtacacagccaccggcagagcgtggaaatcaacttacagaagataaaggccaacaagtca
accacctcagtgcctctgttgcccaacagttgtcccttggatgtatcccacgctatctgc
tccatcggagacagcaaggtgtttgtatgtgggggtgtcaccacagccagcgatgttcag
acaaaggactacaccatcaaccctaatgcttacttgctggaccaaaagataggtgaatgg
aagacccttgcctgcccacccgaggcactggactgccctgcctgctgtctagccaagctg
ccttgcaagattcttcaaagaatttaa

DBGET integrated database retrieval system