KEGG   Rattus norvegicus (rat): 298396Help
Entry
298396            CDS       T01003                                 

Gene name
Olr834
Definition
(RefSeq) olfactory receptor 834
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    298396 (Olr834)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    298396 (Olr834)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 298396
NCBI-ProteinID: NP_001000407
RGD: 1333724
Ensembl: ENSRNOG00000015646
UniProt: D3ZIE7
Position
5q22
AA seq 312 aa AA seqDB search
MEPSNRTAFSEFILKGFSGYPALEHLLFPLCSVMYLVTLLGNTAIVVVSILDARLHTPMY
FFLGNLSILDICYTSTFVPLMLVHLLSSRKTISFSGCAIQMCLSLSTGSTECLLLAVMAY
DRYLAICQPLRYPVLMSHRLCLMLAGTSWVLCLFKSVTETVIAMRLPFCGRHVIRHFTCE
ILAVLKLACGDTSVSDAFLLVGAILLLPVPLTLICLSYMLILATILRVPSATGRRKAFST
CSAHLAVVLLFYSTIIFMYMKPKSKEARISDQVFTVLYAVVTPMLNPIIYSLRNKEVKEA
ARKAWGSRWVCR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggagcccagcaacagaacagcattctctgagttcatcttgaagggattttctggctac
ccagccctggagcacctactctttcctctgtgttcagttatgtacctggtgaccctgctg
gggaacacggccatcgtggtggtgagcatcttggatgctcgcctacacacgcccatgtac
tttttcctgggtaacctttccatcttggacatctgctacacgtctacctttgtgcccctg
atgctggtccacctcctgtcatcccggaagaccatctcctttagtggctgtgccatccag
atgtgtctgagcctctctacgggctccaccgagtgcctgctgctagcggtcatggcctac
gaccgctacttggccatctgccagccgctcaggtaccccgtgctcatgagccacaggctc
tgcctgatgctagcgggaacctcctgggtgctctgcctcttcaagtcagtgacagagacg
gtcatcgccatgaggctgcccttctgcggccgccacgtgatcagacacttcacctgtgag
atcctggctgtgctgaagttggcctgtggggatacatcagtcagcgatgcctttctgctg
gtgggagccatcctcctgctgcccgtacccctgaccctcatctgcctgtcctacatgcta
atcctggccaccatcctgagggtgccctcagccaccgggcgccgcaaagccttctccacc
tgctcggcacacctggctgtggttctgcttttctacagtaccatcatcttcatgtacatg
aaacccaagagcaaagaggctcgtatctcagaccaggtctttacagtcctctacgctgtg
gtgacccccatgctgaaccccattatctacagcctgaggaacaaggaggtaaaggaggct
gccaggaaagcttggggcagcagatgggtctgtaggtga

DBGET integrated database retrieval system