KEGG   Rattus norvegicus (rat): 298399
Entry
298399            CDS       T01003                                 

Gene name
Gba2
Definition
(RefSeq) non-lysosomal glucosylceramidase
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00511  Other glycan degradation
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    298399 (Gba2)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    298399 (Gba2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     298399 (Gba2)
SSDB
Motif
Pfam: DUF608 Glyco_hydr_116N DUF5127 Bac_rhamnosid6H
Other DBs
NCBI-GeneID: 298399
NCBI-ProteinID: NP_001013109
RGD: 1305598
Ensembl: ENSRNOG00000016364
UniProt: D4A6U0
Position
5
AA seq 904 aa
MVTCVPASEQIGCAERDSQIYSEDTGGTEAVRVTDCRSPEDSGPQNEPGYCNSEDSGQLM
ASYEGKARGYQVPPFGWRICLAHEFAEKRKPFQANNVSLSNLVKHFGMGLRYLKWWYRKT
QVEKKTPFIDMFNSVPLRQIYGCPLGGIGGGTITRGWRGQFCRWQLNPGMYQHQTVIADQ
FIVCLRRDGRTVYQQVLSLELPSVLRSWNWGLCGYFAFYHALYPRAWTVYQLPGQNVTLT
CRQITPILPHDYQDSSLPVGVFVWDVENEGDETLDVSIMFSMRNGLGGEDDAAGGLWNEP
FRLEQDGTTVQGLLLHHPTPPNPYTMAVAARHTADTTVTYTTAFDPDSTGQQVWQDLLQD
GQLDSPAGQSTPTQRGEGVAGAVCASSKLLPRGRCCLEFSLAWDMPRIMFGAKGQVHYRR
YTRFFGSDGDVAPALSHYALCQYAGWENSISAWQNPVLDDRSLPAWYKSALFNELYFLAD
GGTVWLEVPEDSLPEELGGSMYQLRPILQDYGRFGYLEGQEYRMYNTYDVHFYASFALVM
LWPKLELSLQYDMALATFKEDLTRRRYLMSGVVAPVKRRNVIPHDIGDPDDEPWLRVNAY
LIHDTADWKDLNLKFVLQVYRDYYLTGDQGFLKDMWPVCLAVMESEMKFDKDQDGLIENG
GYADQTYDGWVTTGPSAYCGGLWLAAVAVMVQMAVLCGAQDVQDKFSSILCRGREAYERL
LWNGRYYNYDSSSQPQSRSVMSDQCAGQWFLRACGLGEGDTEVFPTLHVVRALKTIFELN
VQAFAGGAMGAVNGMQPHGVPDRSSVQSDEVWVGVVYGLAATMIQEGLTWEGFRTAEGCY
RTVWERLGLAFQTPEAYCQQRVFRSLAYMRPLSIWAMQLALQQQQHKKNSSRPAVTQGTA
PSTA
NT seq 2715 nt   +upstreamnt  +downstreamnt
atggtaacctgcgtacctgcctccgagcagatcggctgtgcggaaagagattcacaaatt
tatagtgaagatactggaggcactgaggctgtgcgggttacagactgccggagcccggag
gacagtggaccccagaatgagccaggctactgcaattcagaggactctgggcagctgatg
gcctcctacgagggtaaagctaggggctaccaggtgcctccttttggctggcggatttgc
ttggctcacgagtttgcagagaagaggaaaccttttcaggctaacaacgtctctctcagt
aatttggtaaagcatttcggtatgggcttgaggtacttgaagtggtggtaccggaagacg
caggtggaaaagaagacccctttcatcgacatgttcaattctgtacccctgagacagatc
tacggttgccccttgggtggcattggaggaggcaccatcacccggggctggagaggccag
ttctgtcgttggcagcttaatcctggaatgtaccagcaccagacagtcattgcagaccaa
tttatagtatgcttgcgtcgagatgggcggactgtgtatcagcaagtcctgtccttggag
cttccgagtgtcctgcgcagctggaactggggcctgtgtggttattttgctttctaccac
gccctctatccccgagcctggacagtctatcagcttcctggccagaatgtcaccctcacc
tgtcgccagatcacacctatcttgcctcatgattaccaggacagcagcctccccgtagga
gtgtttgtgtgggatgtagagaatgaaggagatgagactctggatgtgtccatcatgttc
tccatgcggaatggactaggaggtgaagatgatgctgccggaggtttgtggaacgagccc
ttccgtctggaacaggatgggacgactgtacaggggctactcctgcatcatccaacccct
ccgaacccctacaccatggctgtggctgcgcgacacacggcagataccacagtaacctac
accacagcctttgaccccgacagcactgggcagcaggtgtggcaggacctacttcaagat
ggacagctggactcccctgctggccagagcaccccgacacagagaggagagggtgtcgct
ggggctgtatgtgcctccagcaagctgctgccacgaggccggtgctgcttggagttctca
ctggcttgggatatgcctaggatcatgtttggagccaaaggccaagtccactacaggcgg
tatacacggttctttggttcagatggtgatgtggcgcctgccctgagccactatgccctg
tgccagtatgcaggttgggagaacagcatctcagcgtggcagaacccagtactggacgac
agatccttgcctgcctggtacaaatctgcactgttcaatgaactatacttcctggctgat
ggaggcacggtgtggctggaagttcctgaagactccctaccagaggagctgggagggagt
atgtaccagctgcgccctattctgcaggactatgggcgatttggctatctcgaaggccag
gagtaccgcatgtacaacacatacgatgtccacttctacgcttcttttgctctcgtcatg
ctgtggcccaaacttgagctcagtcttcagtatgatatggctctggcaactttcaaggag
gacctgacacggcgacggtacctgatgagtggagtagtggcgcctgtgaaaaggaggaac
gttatccctcatgatattggggatccagatgatgagccatggctccgggtcaacgcatat
ttgatccatgatactgctgactggaaggacctgaacctgaagtttgtgttgcaagtttat
cgggactattacctgacaggcgatcaaggcttcctgaaggacatgtggcctgtgtgtctg
gctgtgatggagtccgaaatgaagtttgataaggaccaagatggactcattgagaatgga
ggctatgcagaccagacctacgatggatgggtcaccacaggccccagtgcttactgcgga
gggctgtggctggcagctgtggctgtgatggtccagatggccgttctgtgtggggcccag
gatgtccaggataagttttcttccattctctgccgaggccgggaagcttatgagagattg
ctctggaacggacgctattacaactacgacagcagctcccagccacagtcccgcagcgtc
atgtctgaccagtgtgctgggcagtggttcctgagggcctgcggcctgggagaaggagac
actgaagtattccctaccctgcatgttgtccgtgctctcaaaaccatctttgagctcaat
gtccaagccttcgcaggaggagccatgggggctgtgaatgggatgcagcctcatggtgtc
cctgataggtccagtgtgcagtctgatgaagtttgggtgggcgtggtctatgggctggca
gccaccatgatccaagagggcctgacttgggaaggtttccggacagctgaaggctgttac
cgcactgtatgggaacgcctgggcctggctttccagaccccagaggcatactgccagcag
cgagtgttccgctccctggcctacatgcggcccctgagcatctgggccatgcagctggcc
cttcaacagcagcagcataaaaagaacagcagccggccagcagtcacacaaggcacagca
cccagcacagcctga

KEGG   Rattus norvegicus (rat): 684536
Entry
684536            CDS       T01003                                 

Gene name
Gba
Definition
(RefSeq) glucosylceramidase precursor
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00511  Other glycan degradation
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    684536 (Gba)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    684536 (Gba)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    684536 (Gba)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     684536 (Gba)
SSDB
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59
Other DBs
NCBI-GeneID: 684536
NCBI-ProteinID: NP_001121111
RGD: 1589149
Ensembl: ENSRNOG00000049281
UniProt: B2RYC9
Position
2
AA seq 515 aa
MAARFIGLFLFQAISWAYGAQPCIPKSFGYSSVVCVCNATYCDSLDPLTLPALGTFSRYE
STRSGRRMELSTGSIQANRTGTGLLLTLQPEEKFQKVKGFGGAMTDATALNILALSPPAQ
KLLLKSYFSSEGIEYNIIRVPMASCDFSIRIYTYADTPNDFQLSNFSLPEEDTKLKIPLI
HRALKMSPRPISLFASPWTSPTWLKTNGAVNGKGSLKGHPGDIYHEAWANYFVKFLDAYA
THNIKFWAVTAENEPSAGLFTGYPFQCLGFTAEHQRDFISHDLGPALANSSHDVKLLILD
DQRLLLPRWAQVVLSDPEAAKYVHGIAVHWYMDFLAPAKATLGETHRLFPNMMLFASEAC
VGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVTGWTDWNLALNPEGGPNWVRNFVDSPI
IVDIPKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASEKTDLETVALIRPDGSAVVVVLN
RSSKDVPLTISDPALGFMETISPGYSIHTYLWRRQ
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggctgccaggttcataggactcttcctatttcaggccatatcttgggcatatggtgcc
caaccctgcatccccaaaagttttggctacagctcagtggtctgtgtctgcaatgcaacg
tactgtgactctcttgaccccctgaccttaccggctctgggtaccttcagccgttatgag
agtactcgaagcggacgtcggatggagctgagtaccgggtccatccaggccaaccgcact
ggcacagggctcctactaaccttgcagccagaagagaagttccagaaagtgaaaggattt
ggaggtgccatgacagatgccactgcgctcaacatccttgccttgtcccccccggctcag
aaactgctactcaagtcctacttctctagcgaaggcattgagtataacatcatccgggta
cccatggccagttgtgacttctccatccgcatctacacctatgctgacacccctaatgac
ttccagttatccaacttcagcctcccggaggaagacaccaagctcaagatacccctgatt
caccgagccctgaagatgtccccacgccccatttcactctttgccagtccctggacatca
cccacttggctcaagaccaatggagcagtgaatgggaaagggtcactcaagggtcaccca
ggggatatctatcacgaggcctgggccaattactttgtcaagtttctggatgcttatgct
acacacaacatcaaattctgggcagtgacagcggagaatgaaccctctgcagggctcttc
actgggtaccccttccaatgcctgggcttcactgctgaacatcagagagactttatttcc
catgatctagggccagcccttgccaacagttctcatgatgtgaagctactcatactggat
gatcagcggctgctgctaccccgctgggcacaggtggtgctctctgacccagaggcagcc
aagtacgttcatggcatcgctgtccactggtatatggatttcctggctccagccaaagct
actttaggagagacacaccgcttgttccccaacatgatgctctttgcttcagaggcctgc
gtgggctccaagttctgggagcagagtgttcggttaggctcctgggatcgagggatgcag
tacagtcacagcatcattacgaacctcctttaccacgtaactggatggactgactggaac
cttgccctgaatcctgaaggagggcccaactgggtccgcaacttcgttgatagccccatc
attgtcgacatccccaaagacacattttacaagcagcccatgttctaccatcttggccac
ttcagcaagttcatccctgagggatctcagcgagtgggcttggtggccagtgagaagacc
gacttggaaacagtggcactgatacgccctgatggctctgcagttgtggtcgtgttaaac
cgatcgtctaaggatgtccctcttaccatcagtgatcctgccctgggcttcatggagacc
atctcacctggctactccattcacacttacctatggcgtcgccagtga

DBGET integrated database retrieval system