KEGG   Rattus norvegicus (rat): 298410Help
Entry
298410            CDS       T01003                                 

Gene name
Cmpk1, CK, Cmpk, RGD1310116
Definition
(RefSeq) cytidine/uridine monophosphate kinase 1
  KO
K13800  UMP-CMP kinase [EC:2.7.4.14]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00240  Pyrimidine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
Module
rno_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    298410 (Cmpk1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    298410 (Cmpk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.14  UMP/CMP kinase
     298410 (Cmpk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADK AAA_17 AAA_18 Thymidylate_kin AAA_33 Zeta_toxin Ploopntkinase3
Motif
Other DBs
NCBI-GeneID: 298410
NCBI-ProteinID: NP_001020826
RGD: 1310116
Ensembl: ENSRNOG00000007775
UniProt: Q4KM73 A0A0G2JSJ2
Position
5q35
AA seq 227 aa AA seqDB search
MLSSCRRWLLHVLVPSFPPLTRGLRFFPLQLMKPLVVFVLGGPGAGKGTQCARIVEKYGY
THLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKF
LIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIDRCLERGKSSGRSDDNRESLE
KRIQTYLESTKPIIDLYEEMGKVKKIDASKSVDEVFGDVMKIFDKEG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcagctgtcgtcgctggctgctgcacgtcctggtcccgagcttcccgccgcta
acccgcggactgcggttcttccctctccaactcatgaagccgttggtcgtgttcgttttg
ggcgggcccggtgcgggcaaggggacccagtgcgcgcgcattgttgagaaatatggctac
acacacctttctgcaggagagcttcttcgtgatgaaaggaagaatccagattcacagtat
ggtgaacttattgaaaagtacattaaagaaggaaagattgtaccagttgagataaccatc
agtttattaaagagggaaatggaccaaacaatggctgccaatgctcagaagaataaattc
ttgattgatggctttccaagaaatcaagacaaccttcagggttggaacaagaccatggat
gggaaagcagatgtatcttttgttctgttttttgactgtaataatgagatctgtattgac
cgatgtcttgaaaggggaaaaagtagtggtaggagtgatgacaacagagagagcttggaa
aagagaattcagacttatcttgaatcaacaaaaccaattattgacctatatgaagaaatg
ggcaaagtcaagaaaatagacgcttctaagtctgttgatgaagtttttggtgacgttatg
aagatttttgacaaagaaggctaa

KEGG   Rattus norvegicus (rat): 314004Help
Entry
314004            CDS       T01003                                 

Gene name
Cmpk2, Tyki
Definition
(RefSeq) cytidine/uridine monophosphate kinase 2
  KO
K13809  UMP-CMP kinase 2, mitochondrial [EC:2.7.4.14]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00240  Pyrimidine metabolism
rno01100  Metabolic pathways
Module
rno_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    314004 (Cmpk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.14  UMP/CMP kinase
     314004 (Cmpk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymidylate_kin AAA_18 AAA_33 dNK MltA
Motif
Other DBs
NCBI-GeneID: 314004
NCBI-ProteinID: NP_001101487
RGD: 1305881
Ensembl: ENSRNOG00000007690
Position
6q16
AA seq 417 aa AA seqDB search
MARPRRFTVELPDCSLTHFVLGDAAGHRDARLTELLGPPGRSYALCVPLVPGEGCGPRVQ
AARVYQRLQLQLRQGPLQRCELSKLLGYGPGDQASEAQHGFLLRDPSDHPDTRQDLLQLL
GSCQEATRLHLAEFQADSQGLLWQRLWELQGDRQVQVDCACVLPAPEPHLHPLLPDLLNS
AVFQDRDAARAVLEECTSFIPEAREVLDLVDQCPREIQKGKFQVIAIEGLDATGKTTLTQ
SVSESLQAVLLQSPPPCISQWRKLFDDEPTIIRRAFYSLGNYLVASEIAKQSAKFPVIVD
RYWHSTATYAIATEVSGGLQYLPPAHHPVYQWPRDLLKPDLVLLLTVNSEERVRRLQGRG
QEKTKEEAELEVNSVFRQKVEATYQRMENPSCRLVDASPSRETVLQTVLQLIQRAGH
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctcggccgcggcgcttcactgtagagctgcccgattgctccctgactcacttcgtc
ctgggggacgcggcgggccaccgggatgctcgccttacggagctgctcgggcccccaggg
cgcagctacgcgctgtgtgtgccattggttccaggcgaaggctgtgggccccgggtacag
gcggcccgggtgtaccagcgcctgcagctgcagctgcgccagggtcctttgcagaggtgc
gagctgagcaaactgctgggatatggtccaggcgatcaggccagcgaagcccagcatggc
ttcctgctgcgcgaccccagcgaccacccggacacccggcaagacttgctgcagcttctg
ggctcatgccaggaggcgacacggctgcacttggcggagttccaggccgattcccaggga
ttgctgtggcagcgtctgtgggagttgcagggagacagacaggtgcaggtggactgcgca
tgcgtcctgccggcaccggagccccatctgcacccactgctgcctgatctgctcaactct
gcggtgtttcaagaccgggacgctgcacgggctgtcttggaggagtgcacatcttttatt
ccagaagcccgggaagtgcttgacctagttgaccagtgcccaagggagatccagaaaggg
aagttccaggtcattgccattgaaggactggatgccactggtaagaccacactgacgcag
tccgtgtcagagtctctccaagctgtcctcttacagtctccacccccctgcatcagccag
tggaggaagctctttgatgatgagcctactatcattcggagagcattttactctttgggc
aattatctcgtggcttctgaaatagctaaacagtcagccaagtttcctgttatcgtagac
aggtactggcatagcacagccacctatgccatagccactgaggtgagtggaggcctacag
tacctaccccctgcccaccaccctgtgtaccagtggccaagagacctgctgaagcctgac
ctggtcctgctgcttactgtgaattctgaggagagagtgcggagactgcagggtcggggc
caggagaagactaaagaagaggctgaactcgaggtcaacagcgtgtttcgtcagaaggtg
gaagccacgtaccagcgtatggagaacccaagctgccgtctggtcgatgccagcccgtcc
agagagacagtgctgcagacagttttacagctgatccagagggctggtcattaa

DBGET integrated database retrieval system