KEGG   Rattus norvegicus (rat): 298423Help
Entry
298423            CDS       T01003                                 

Gene name
Cyp4a3, CYPIVA3, Cyp4a14
Definition
(RefSeq) cytochrome P450, family 4, subfamily a, polypeptide 3
  KO
K07425  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00071  Fatty acid degradation
rno00590  Arachidonic acid metabolism
rno00830  Retinol metabolism
rno01100  Metabolic pathways
rno03320  PPAR signaling pathway
rno04270  Vascular smooth muscle contraction
rno04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    298423 (Cyp4a3)
   00590 Arachidonic acid metabolism
    298423 (Cyp4a3)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    298423 (Cyp4a3)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    298423 (Cyp4a3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    298423 (Cyp4a3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    298423 (Cyp4a3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rno00199]
    298423 (Cyp4a3)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     298423 (Cyp4a3)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP4 family
   298423 (Cyp4a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 298423
NCBI-ProteinID: NP_786936
RGD: 631356
Ensembl: ENSRNOG00000009741
UniProt: P20817
Position
5q35
AA seq 507 aa AA seqDB search
MGFSVFTPTRSLDGVSGFFQGAFLLSLFLVLFKAVQFYLRRQWLLKALEKFPSTPSHWLW
GHDLKDREFQQVLTWVEKFPGACLQWLSGSKTRVLLYDPDYVKVVLGRSDPKASGIYQFL
APWIGYGLLLLNGKKWFQHRRMLTPAFHYGILKPYVKIMADSVNIMLDKWEKLDDQDHPL
EIFHYVSLMTLDTVMKCAFSHQGSVQLDVNSRSYTKAVEDLNNLTFFRVRSAFYGNSIIY
NMSSDGRLSRRACQIAHEHTDGVIKMRKAQLQNEEELQKARKKRHLDFLDILLFAKMEDG
KSLSDEDLRAEVDTFMFEGHDTTASGISWVFYALATHPEHQERCREEVQSILGDGTSVTW
DHLDQIPYTTMCIKEALRLYPPVPSVSRELSSPVTFPDGRSIPKGITTTILIYGLHHNPS
YWPNPKVFDPSRFSPDSPRHSHAYLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLPD
PTRIPVPMARLVLKSKNGIHLRLKKLR
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgggtttctctgtatttacccctacaagatccctggatggtgtctctgggttcttccaa
ggggccttcctgctcagtctatttctggtgctgttcaaggcagtccaattctacttacga
aggcaatggctgctcaaggccctcgagaagttcccatccacgccttcccactggctttgg
ggccacgacctgaaggacagagaattccagcaggttcttacgtgggtagagaaattccca
ggtgcctgcttacagtggctctcagggagcaaaacacgagtcctgctctatgaccctgac
tatgtgaaggtggttctgggaagatcagatccaaaggcttctggaatttatcaattcctt
gctccctggattggttatggtttgctcctgttgaatgggaagaaatggttccagcatcgg
cggatgttgactccagccttccactatggcatcctcaaaccctatgtcaaaatcatggcg
gactctgtcaatataatgctagacaaatgggagaagcttgatgaccaggatcaccctcta
gagatcttccactatgtctccttgatgacactggacactgttatgaagtgtgctttcagc
catcagggcagtgttcagttggatgtaaattccaggtcctacaccaaggctgtcgaggat
ctaaacaacctgactttctttcgtgtgaggagtgccttttatgggaacagcatcatctac
aatatgtcctctgatggccgtttgtcccgccgggcctgccagattgctcatgagcacaca
gatggagtgatcaaaatgaggaaggctcagctgcagaatgaggaagagcttcagaaggcc
aggaagaagaggcacttggatttcctggacatcctgttgtttgccaaaatggaggatggg
aagagcttgtctgatgaggacctgcgtgcagaggtggacacattcatgtttgagggtcat
gacaccacagccagtggaatctcctgggttttctatgctctggccacccaccctgagcac
caagagagatgcagagaggaggtgcagagcattctgggtgatggaacctctgtcacatgg
gaccacctggaccagataccttacaccaccatgtgcatcaaggaggccctgaggctctac
ccaccagtaccttctgtgagtcgagagctcagctcccctgtcaccttcccagatggacgt
tccatacccaaaggtatcacaaccacaattttaatttatggccttcatcataacccaagt
tactggccaaacccaaaggtgtttgacccctctagattctcaccagattctcctcgccat
agccatgcttatctgccattctcaggaggagcaaggaactgcattgggaaacagtttgcc
atgaatgagctgaaggtggctgtggccctgaccctgcttcgctttgagttgctgccagat
cccaccaggatcccggtccctatggcaagacttgtgttgaagtccaagaatgggatccac
ctgcgtctcaagaagctaagataa

DBGET integrated database retrieval system